Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2Z1L1

Protein Details
Accession A0A0C2Z1L1    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MNSTNRRSLKQPKRQKEKFRFLEVERHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito 8
Family & Domain DBs
Amino Acid Sequences MNSTNRRSLKQPKRQKEKFRFLEVERFLRACNPPMDHHLQRFIDFGCDNEEFLRGISSWAEGNRVAILKKILTRPKGESGVTEMEVAVIDNNLEAYFGDDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.93
3 0.93
4 0.93
5 0.89
6 0.87
7 0.83
8 0.75
9 0.75
10 0.69
11 0.62
12 0.53
13 0.46
14 0.37
15 0.35
16 0.33
17 0.27
18 0.26
19 0.25
20 0.24
21 0.29
22 0.36
23 0.35
24 0.34
25 0.37
26 0.34
27 0.32
28 0.31
29 0.25
30 0.21
31 0.18
32 0.17
33 0.14
34 0.14
35 0.13
36 0.12
37 0.13
38 0.1
39 0.1
40 0.1
41 0.06
42 0.06
43 0.06
44 0.06
45 0.07
46 0.07
47 0.09
48 0.08
49 0.08
50 0.09
51 0.1
52 0.1
53 0.1
54 0.11
55 0.11
56 0.15
57 0.22
58 0.28
59 0.31
60 0.35
61 0.38
62 0.43
63 0.45
64 0.42
65 0.36
66 0.34
67 0.34
68 0.31
69 0.26
70 0.2
71 0.16
72 0.15
73 0.14
74 0.09
75 0.06
76 0.05
77 0.04
78 0.05
79 0.05
80 0.05
81 0.05