Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3CKI9

Protein Details
Accession A0A0C3CKI9    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
102-130FKDGKKAEKKVKAPKSPKKEKKKEEAEAABasic
NLS Segment(s)
PositionSequence
83-125AKKEERPKSPSLLSKLLAPFKDGKKAEKKVKAPKSPKKEKKKE
178-214KKEEKKEEKKEAKEAKAVKVGRRLSARVGDFFKAKPK
Subcellular Location(s) cyto 15.5, cyto_nucl 11.833, nucl 7, mito_nucl 5.833, mito 3.5
Family & Domain DBs
Amino Acid Sequences MSAPEAAAVVAPVEDVKPVEATPTPAVEAEPTKVEEAPAPVPAVEAPAPAAEAEAPAAPAVEADAAPAVEEAKEESKPAEAEAKKEERPKSPSLLSKLLAPFKDGKKAEKKVKAPKSPKKEKKKEEAEAAAPAPEEAAKEEPVPAEAPVEAAKEEVAEPVKETETAAPPAAEAEEAEKKEEKKEEKKEAKEAKAVKVGRRLSARVGDFFKAKPKPEVTPPAKVDEHPPKIDEPAPVAPLENPASEAAAAPESKTEEAAKPVEAAPAVTPVVAAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.08
4 0.09
5 0.09
6 0.12
7 0.12
8 0.17
9 0.18
10 0.19
11 0.19
12 0.18
13 0.18
14 0.18
15 0.19
16 0.17
17 0.17
18 0.17
19 0.18
20 0.18
21 0.18
22 0.17
23 0.19
24 0.18
25 0.18
26 0.16
27 0.15
28 0.15
29 0.14
30 0.15
31 0.12
32 0.11
33 0.1
34 0.09
35 0.09
36 0.09
37 0.09
38 0.06
39 0.06
40 0.06
41 0.06
42 0.06
43 0.05
44 0.06
45 0.05
46 0.05
47 0.05
48 0.05
49 0.04
50 0.04
51 0.05
52 0.05
53 0.05
54 0.05
55 0.05
56 0.04
57 0.05
58 0.06
59 0.08
60 0.09
61 0.09
62 0.1
63 0.11
64 0.12
65 0.13
66 0.2
67 0.18
68 0.21
69 0.27
70 0.32
71 0.34
72 0.41
73 0.44
74 0.41
75 0.46
76 0.47
77 0.46
78 0.46
79 0.48
80 0.47
81 0.47
82 0.41
83 0.4
84 0.41
85 0.4
86 0.34
87 0.3
88 0.31
89 0.29
90 0.37
91 0.33
92 0.35
93 0.4
94 0.48
95 0.55
96 0.57
97 0.64
98 0.65
99 0.74
100 0.78
101 0.79
102 0.8
103 0.82
104 0.85
105 0.87
106 0.88
107 0.89
108 0.87
109 0.86
110 0.86
111 0.81
112 0.76
113 0.7
114 0.6
115 0.52
116 0.44
117 0.34
118 0.24
119 0.19
120 0.12
121 0.08
122 0.06
123 0.05
124 0.06
125 0.07
126 0.07
127 0.07
128 0.07
129 0.08
130 0.08
131 0.07
132 0.06
133 0.06
134 0.06
135 0.06
136 0.07
137 0.06
138 0.05
139 0.05
140 0.05
141 0.05
142 0.06
143 0.07
144 0.07
145 0.07
146 0.08
147 0.09
148 0.09
149 0.09
150 0.1
151 0.11
152 0.13
153 0.13
154 0.11
155 0.11
156 0.11
157 0.1
158 0.08
159 0.05
160 0.07
161 0.11
162 0.12
163 0.14
164 0.17
165 0.17
166 0.21
167 0.28
168 0.32
169 0.37
170 0.46
171 0.55
172 0.62
173 0.66
174 0.72
175 0.74
176 0.71
177 0.68
178 0.63
179 0.57
180 0.56
181 0.55
182 0.49
183 0.49
184 0.47
185 0.45
186 0.45
187 0.42
188 0.38
189 0.41
190 0.39
191 0.35
192 0.36
193 0.33
194 0.31
195 0.31
196 0.35
197 0.33
198 0.34
199 0.36
200 0.36
201 0.39
202 0.45
203 0.54
204 0.51
205 0.55
206 0.55
207 0.55
208 0.53
209 0.49
210 0.5
211 0.49
212 0.51
213 0.44
214 0.43
215 0.39
216 0.41
217 0.43
218 0.36
219 0.31
220 0.28
221 0.27
222 0.25
223 0.25
224 0.21
225 0.23
226 0.23
227 0.18
228 0.16
229 0.15
230 0.15
231 0.14
232 0.14
233 0.11
234 0.12
235 0.12
236 0.1
237 0.12
238 0.14
239 0.14
240 0.16
241 0.17
242 0.17
243 0.21
244 0.23
245 0.22
246 0.21
247 0.22
248 0.23
249 0.2
250 0.18
251 0.15
252 0.16
253 0.15
254 0.13
255 0.12