Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2Z1D3

Protein Details
Accession A0A0C2Z1D3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
58-77MAVAKKKKAKKQTQAAAAVKHydrophilic
NLS Segment(s)
PositionSequence
62-68KKKKAKK
Subcellular Location(s) mito 15, cyto_mito 11.833, mito_nucl 10.333, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MQGMKAELKHLLSQPLLAKGISARYITSGSRPIVDDLLAGELNETMVGLKKAEAGSEMAVAKKKKAKKQTQAAAAVKDEQLEEEWSGITEVAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.26
4 0.21
5 0.2
6 0.17
7 0.19
8 0.18
9 0.16
10 0.12
11 0.13
12 0.15
13 0.15
14 0.17
15 0.19
16 0.17
17 0.18
18 0.18
19 0.18
20 0.16
21 0.16
22 0.13
23 0.09
24 0.1
25 0.08
26 0.07
27 0.06
28 0.05
29 0.05
30 0.05
31 0.04
32 0.03
33 0.03
34 0.04
35 0.04
36 0.04
37 0.06
38 0.06
39 0.07
40 0.07
41 0.07
42 0.08
43 0.1
44 0.1
45 0.1
46 0.14
47 0.15
48 0.18
49 0.23
50 0.3
51 0.36
52 0.47
53 0.56
54 0.62
55 0.72
56 0.77
57 0.79
58 0.82
59 0.77
60 0.7
61 0.61
62 0.53
63 0.43
64 0.35
65 0.26
66 0.17
67 0.16
68 0.15
69 0.13
70 0.12
71 0.11
72 0.11
73 0.12