Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3CH07

Protein Details
Accession A0A0C3CH07    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MKSNHKKRKYRPPTRHDSHPLAHBasic
NLS Segment(s)
PositionSequence
7-8KR
Subcellular Location(s) mito 14, nucl 11
Family & Domain DBs
Amino Acid Sequences MKSNHKKRKYRPPTRHDSHPLAHSQAPVFLGHHDAFFQSETTRDKSSERDPLSALYIQAHEADVVHGSAAATAAQSLEVVEYQTSPSGVDVIRKIGSALIRWGDGAGASRSPLTDIDDESVHPRRKDAESEVWVDRYVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.89
3 0.86
4 0.81
5 0.75
6 0.69
7 0.62
8 0.56
9 0.51
10 0.43
11 0.35
12 0.29
13 0.25
14 0.21
15 0.18
16 0.14
17 0.16
18 0.14
19 0.14
20 0.13
21 0.12
22 0.12
23 0.12
24 0.12
25 0.08
26 0.11
27 0.14
28 0.17
29 0.18
30 0.18
31 0.19
32 0.23
33 0.28
34 0.33
35 0.33
36 0.31
37 0.3
38 0.3
39 0.31
40 0.28
41 0.23
42 0.15
43 0.13
44 0.12
45 0.11
46 0.1
47 0.07
48 0.06
49 0.06
50 0.05
51 0.05
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.04
68 0.04
69 0.04
70 0.05
71 0.05
72 0.05
73 0.05
74 0.06
75 0.06
76 0.09
77 0.09
78 0.11
79 0.12
80 0.12
81 0.12
82 0.12
83 0.13
84 0.12
85 0.14
86 0.12
87 0.12
88 0.12
89 0.12
90 0.1
91 0.09
92 0.11
93 0.09
94 0.08
95 0.09
96 0.09
97 0.09
98 0.1
99 0.11
100 0.12
101 0.12
102 0.13
103 0.15
104 0.15
105 0.16
106 0.21
107 0.29
108 0.31
109 0.3
110 0.3
111 0.33
112 0.36
113 0.41
114 0.42
115 0.43
116 0.42
117 0.47
118 0.49
119 0.45