Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2Y5B6

Protein Details
Accession A0A0C2Y5B6    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
65-90RGTEYQPSQRKRKRKHGFLARKKTVGBasic
NLS Segment(s)
PositionSequence
74-105RKRKRKHGFLARKKTVGGRRVLSRRLAKGRKN
Subcellular Location(s) mito 19, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPRIPPALLAVLRRPPPPLPIINAARLVARLAPRPTALPSLFRIQHTPPITQSLLFQLPVRFAARGTEYQPSQRKRKRKHGFLARKKTVGGRRVLSRRLAKGRKNLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.32
3 0.34
4 0.36
5 0.34
6 0.31
7 0.36
8 0.39
9 0.39
10 0.39
11 0.35
12 0.3
13 0.27
14 0.23
15 0.17
16 0.16
17 0.18
18 0.18
19 0.19
20 0.19
21 0.21
22 0.22
23 0.24
24 0.22
25 0.2
26 0.21
27 0.25
28 0.26
29 0.26
30 0.27
31 0.23
32 0.3
33 0.29
34 0.28
35 0.23
36 0.25
37 0.25
38 0.22
39 0.21
40 0.17
41 0.15
42 0.14
43 0.15
44 0.11
45 0.11
46 0.12
47 0.13
48 0.1
49 0.09
50 0.1
51 0.12
52 0.13
53 0.15
54 0.18
55 0.18
56 0.25
57 0.33
58 0.38
59 0.46
60 0.52
61 0.6
62 0.65
63 0.76
64 0.79
65 0.81
66 0.86
67 0.87
68 0.9
69 0.91
70 0.93
71 0.88
72 0.8
73 0.71
74 0.69
75 0.65
76 0.6
77 0.56
78 0.5
79 0.53
80 0.59
81 0.61
82 0.62
83 0.61
84 0.64
85 0.68
86 0.71
87 0.7
88 0.72