Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2YX83

Protein Details
Accession A0A0C2YX83    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
49-74QDGWTKVEKRKKKKEVKKVDTGRSRDBasic
NLS Segment(s)
PositionSequence
56-66EKRKKKKEVKK
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MKRGHAEVMSGTTQPLKKAKTSSSEEASDDTIPVNVNGLPSTTNEQQHQDGWTKVEKRKKKKEVKKVDTGRSRDVRYAVYLTFRDQRTLFVHHVANHHHFHFVLPVCADNESEVHVFES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.28
3 0.27
4 0.29
5 0.34
6 0.38
7 0.4
8 0.47
9 0.49
10 0.48
11 0.48
12 0.44
13 0.41
14 0.38
15 0.3
16 0.23
17 0.17
18 0.13
19 0.11
20 0.1
21 0.09
22 0.07
23 0.07
24 0.07
25 0.07
26 0.07
27 0.08
28 0.14
29 0.16
30 0.18
31 0.19
32 0.22
33 0.22
34 0.23
35 0.24
36 0.21
37 0.19
38 0.18
39 0.22
40 0.25
41 0.28
42 0.36
43 0.42
44 0.5
45 0.6
46 0.68
47 0.74
48 0.79
49 0.85
50 0.88
51 0.87
52 0.87
53 0.85
54 0.84
55 0.81
56 0.75
57 0.72
58 0.66
59 0.6
60 0.52
61 0.45
62 0.37
63 0.31
64 0.28
65 0.21
66 0.2
67 0.19
68 0.2
69 0.25
70 0.24
71 0.25
72 0.23
73 0.26
74 0.26
75 0.3
76 0.29
77 0.26
78 0.29
79 0.29
80 0.32
81 0.34
82 0.36
83 0.34
84 0.33
85 0.3
86 0.27
87 0.25
88 0.28
89 0.24
90 0.21
91 0.19
92 0.2
93 0.19
94 0.2
95 0.2
96 0.14
97 0.14
98 0.14
99 0.14