Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3CF67

Protein Details
Accession A0A0C3CF67    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
9-35AASSGGKSAKKKKWSKGKVKDKAVHAVHydrophilic
NLS Segment(s)
PositionSequence
7-30APAASSGGKSAKKKKWSKGKVKDK
Subcellular Location(s) nucl 14, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAKAAPAASSGGKSAKKKKWSKGKVKDKAVHAVSLDKTIYDRILKEVPTFKFISQSILIERLKINGSLARVAIRHLEREKLIKPIVHHSAQLIYTRTTSSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.33
3 0.41
4 0.45
5 0.54
6 0.62
7 0.7
8 0.76
9 0.81
10 0.85
11 0.87
12 0.9
13 0.89
14 0.91
15 0.87
16 0.8
17 0.78
18 0.69
19 0.59
20 0.49
21 0.43
22 0.34
23 0.3
24 0.25
25 0.16
26 0.15
27 0.14
28 0.14
29 0.11
30 0.11
31 0.12
32 0.14
33 0.15
34 0.17
35 0.22
36 0.21
37 0.24
38 0.24
39 0.21
40 0.22
41 0.22
42 0.23
43 0.17
44 0.18
45 0.15
46 0.19
47 0.19
48 0.17
49 0.17
50 0.15
51 0.15
52 0.14
53 0.14
54 0.11
55 0.12
56 0.12
57 0.13
58 0.13
59 0.12
60 0.13
61 0.18
62 0.17
63 0.22
64 0.22
65 0.25
66 0.26
67 0.31
68 0.32
69 0.32
70 0.34
71 0.31
72 0.32
73 0.36
74 0.41
75 0.38
76 0.36
77 0.32
78 0.33
79 0.32
80 0.34
81 0.28
82 0.23
83 0.22