Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2Y8N8

Protein Details
Accession A0A0C2Y8N8    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
80-121PLDLRPKKTRAIRRRLTKHEASLKTLKQRKKDANFPIRKYAVHydrophilic
NLS Segment(s)
PositionSequence
84-115RPKKTRAIRRRLTKHEASLKTLKQRKKDANFP
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MAKVKAYELQSKSKNDLSKQLVELKNELLTLRVQKIAGGSASKLTRISTVRKSIARVMTVTNQKARQNLREYYKDKKYLPLDLRPKKTRAIRRRLTKHEASLKTLKQRKKDANFPIRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.49
3 0.54
4 0.5
5 0.49
6 0.49
7 0.53
8 0.51
9 0.47
10 0.46
11 0.38
12 0.33
13 0.29
14 0.25
15 0.17
16 0.16
17 0.17
18 0.17
19 0.17
20 0.16
21 0.16
22 0.16
23 0.16
24 0.15
25 0.12
26 0.11
27 0.13
28 0.14
29 0.14
30 0.14
31 0.13
32 0.15
33 0.17
34 0.22
35 0.24
36 0.29
37 0.32
38 0.34
39 0.35
40 0.37
41 0.37
42 0.33
43 0.28
44 0.24
45 0.26
46 0.29
47 0.29
48 0.27
49 0.28
50 0.29
51 0.33
52 0.33
53 0.33
54 0.34
55 0.37
56 0.39
57 0.44
58 0.46
59 0.49
60 0.53
61 0.53
62 0.49
63 0.51
64 0.48
65 0.48
66 0.5
67 0.52
68 0.56
69 0.59
70 0.67
71 0.64
72 0.64
73 0.62
74 0.66
75 0.67
76 0.67
77 0.69
78 0.7
79 0.76
80 0.83
81 0.85
82 0.84
83 0.8
84 0.78
85 0.78
86 0.71
87 0.67
88 0.65
89 0.62
90 0.64
91 0.66
92 0.63
93 0.61
94 0.68
95 0.72
96 0.72
97 0.77
98 0.77
99 0.81
100 0.85
101 0.82
102 0.82
103 0.76