Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2Y713

Protein Details
Accession A0A0C2Y713   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
52-77NAGTKLKHISKRKGRYPNRVGRWREWHydrophilic
NLS Segment(s)
PositionSequence
58-70KHISKRKGRYPNR
Subcellular Location(s) cyto 7, mito 6, extr 6, pero 6
Family & Domain DBs
Amino Acid Sequences MELPRTPLCDDLKSGQVKLNVLAEFLVNPGIKLLLLSILDLTNLAGRVQCRNAGTKLKHISKRKGRYPNRVGRWREWALREKCASLVAAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.33
3 0.32
4 0.31
5 0.29
6 0.3
7 0.22
8 0.2
9 0.19
10 0.15
11 0.12
12 0.12
13 0.13
14 0.08
15 0.08
16 0.08
17 0.08
18 0.07
19 0.07
20 0.07
21 0.05
22 0.05
23 0.05
24 0.06
25 0.05
26 0.06
27 0.06
28 0.06
29 0.05
30 0.05
31 0.05
32 0.05
33 0.06
34 0.08
35 0.09
36 0.11
37 0.12
38 0.15
39 0.18
40 0.25
41 0.26
42 0.32
43 0.4
44 0.45
45 0.53
46 0.57
47 0.64
48 0.67
49 0.75
50 0.76
51 0.79
52 0.8
53 0.83
54 0.86
55 0.86
56 0.86
57 0.86
58 0.82
59 0.76
60 0.76
61 0.71
62 0.67
63 0.63
64 0.63
65 0.58
66 0.6
67 0.58
68 0.5
69 0.45
70 0.41
71 0.35