Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3CU57

Protein Details
Accession A0A0C3CU57    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
6-31LNPADAFRKAQRKKELKKARFGSYSCHydrophilic
NLS Segment(s)
PositionSequence
13-24RKAQRKKELKKA
105-105R
118-121KKRN
124-124K
Subcellular Location(s) nucl 10mito 10mito_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR019007  WW_dom-bd_prot_11  
Gene Ontology GO:0006396  P:RNA processing  
Pfam View protein in Pfam  
PF12622  NpwBP  
PF09429  Wbp11  
Amino Acid Sequences MAKKNLNPADAFRKAQRKKELKKARFGSYSCTFILTRGFAVEQDREVKSTRLCTYLELAIKELEESRSDAEKLAELKAELEKINRKKAEYVEEHPEQRRLVYRRRKEGEPEPDLPILKKRNLFKKNGLPRHPERSIYYDPIMNPFGVAPPGMQYAERPLLPGEVDSDAEMDEVDDDIPLPSGLPPGTEEVQSDDDIPMPDGPPPGQVSEKDLHPLPPLPLDPPPPPFLTTTAPGSVLPPPPPPPPGFQVQNMTLPPPPPPPVGFPVSNAPPMSFPPPPGAPWPNPAPGYFGQVPPPPPLPGFSPFPGTSFPPFPPNAFPPPPPKFLPRQQSTSAMQDPLSAVPHQTFQAHRASQLGPPHPSLPANPSSRPTLPTNSSLPEKPTAAAELAAATVFSAPQLRDFKKEATAFIPSAVKRKKVSAPSISSTLDTAPSIGSAAPAVDGGEQVEHARPDLVTALKNQFGPGPPKSTKKEPIPKSDYDKFVEEMGDILGPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.67
3 0.71
4 0.72
5 0.76
6 0.83
7 0.86
8 0.84
9 0.88
10 0.86
11 0.84
12 0.81
13 0.73
14 0.7
15 0.64
16 0.6
17 0.49
18 0.46
19 0.37
20 0.29
21 0.32
22 0.26
23 0.21
24 0.19
25 0.19
26 0.17
27 0.21
28 0.22
29 0.21
30 0.25
31 0.25
32 0.25
33 0.27
34 0.29
35 0.28
36 0.33
37 0.32
38 0.3
39 0.3
40 0.3
41 0.32
42 0.34
43 0.35
44 0.29
45 0.28
46 0.25
47 0.25
48 0.23
49 0.21
50 0.17
51 0.14
52 0.15
53 0.17
54 0.19
55 0.19
56 0.2
57 0.19
58 0.21
59 0.21
60 0.21
61 0.19
62 0.16
63 0.17
64 0.18
65 0.2
66 0.18
67 0.22
68 0.3
69 0.35
70 0.44
71 0.45
72 0.45
73 0.48
74 0.51
75 0.55
76 0.52
77 0.51
78 0.5
79 0.53
80 0.57
81 0.55
82 0.53
83 0.44
84 0.4
85 0.43
86 0.41
87 0.46
88 0.51
89 0.57
90 0.64
91 0.69
92 0.71
93 0.7
94 0.73
95 0.73
96 0.69
97 0.63
98 0.57
99 0.55
100 0.51
101 0.45
102 0.42
103 0.38
104 0.36
105 0.38
106 0.41
107 0.49
108 0.55
109 0.61
110 0.62
111 0.67
112 0.73
113 0.77
114 0.77
115 0.75
116 0.74
117 0.76
118 0.71
119 0.63
120 0.56
121 0.54
122 0.51
123 0.47
124 0.42
125 0.36
126 0.34
127 0.34
128 0.32
129 0.24
130 0.19
131 0.15
132 0.14
133 0.11
134 0.11
135 0.07
136 0.07
137 0.09
138 0.09
139 0.09
140 0.08
141 0.13
142 0.15
143 0.15
144 0.14
145 0.13
146 0.14
147 0.14
148 0.14
149 0.11
150 0.09
151 0.09
152 0.09
153 0.09
154 0.08
155 0.07
156 0.07
157 0.05
158 0.04
159 0.04
160 0.04
161 0.04
162 0.04
163 0.04
164 0.04
165 0.04
166 0.04
167 0.04
168 0.06
169 0.06
170 0.06
171 0.07
172 0.09
173 0.11
174 0.11
175 0.11
176 0.13
177 0.14
178 0.14
179 0.14
180 0.11
181 0.12
182 0.12
183 0.12
184 0.1
185 0.08
186 0.09
187 0.09
188 0.09
189 0.1
190 0.11
191 0.11
192 0.12
193 0.12
194 0.15
195 0.17
196 0.17
197 0.17
198 0.17
199 0.17
200 0.17
201 0.18
202 0.14
203 0.14
204 0.14
205 0.14
206 0.15
207 0.18
208 0.18
209 0.2
210 0.21
211 0.2
212 0.21
213 0.2
214 0.21
215 0.19
216 0.19
217 0.18
218 0.16
219 0.16
220 0.15
221 0.15
222 0.16
223 0.15
224 0.15
225 0.15
226 0.17
227 0.18
228 0.2
229 0.2
230 0.2
231 0.21
232 0.24
233 0.24
234 0.24
235 0.26
236 0.25
237 0.26
238 0.24
239 0.23
240 0.19
241 0.17
242 0.17
243 0.16
244 0.17
245 0.15
246 0.16
247 0.17
248 0.2
249 0.23
250 0.21
251 0.2
252 0.22
253 0.23
254 0.24
255 0.21
256 0.18
257 0.15
258 0.16
259 0.18
260 0.15
261 0.14
262 0.15
263 0.16
264 0.17
265 0.21
266 0.24
267 0.21
268 0.24
269 0.27
270 0.27
271 0.27
272 0.26
273 0.26
274 0.22
275 0.27
276 0.24
277 0.22
278 0.22
279 0.24
280 0.25
281 0.23
282 0.24
283 0.19
284 0.18
285 0.19
286 0.18
287 0.19
288 0.21
289 0.19
290 0.23
291 0.22
292 0.23
293 0.23
294 0.22
295 0.22
296 0.21
297 0.21
298 0.21
299 0.21
300 0.21
301 0.24
302 0.26
303 0.3
304 0.3
305 0.33
306 0.37
307 0.41
308 0.44
309 0.43
310 0.43
311 0.43
312 0.49
313 0.56
314 0.51
315 0.52
316 0.51
317 0.53
318 0.52
319 0.5
320 0.45
321 0.36
322 0.31
323 0.26
324 0.24
325 0.19
326 0.19
327 0.13
328 0.11
329 0.11
330 0.12
331 0.12
332 0.14
333 0.14
334 0.14
335 0.22
336 0.22
337 0.22
338 0.23
339 0.24
340 0.25
341 0.31
342 0.33
343 0.28
344 0.29
345 0.3
346 0.28
347 0.27
348 0.25
349 0.24
350 0.27
351 0.28
352 0.28
353 0.3
354 0.34
355 0.35
356 0.37
357 0.36
358 0.35
359 0.34
360 0.36
361 0.36
362 0.35
363 0.37
364 0.35
365 0.35
366 0.31
367 0.29
368 0.25
369 0.23
370 0.21
371 0.18
372 0.16
373 0.13
374 0.1
375 0.09
376 0.08
377 0.07
378 0.05
379 0.05
380 0.04
381 0.05
382 0.07
383 0.07
384 0.14
385 0.22
386 0.23
387 0.28
388 0.32
389 0.34
390 0.39
391 0.41
392 0.37
393 0.32
394 0.35
395 0.31
396 0.3
397 0.34
398 0.27
399 0.35
400 0.37
401 0.39
402 0.37
403 0.43
404 0.48
405 0.51
406 0.58
407 0.58
408 0.6
409 0.6
410 0.62
411 0.57
412 0.5
413 0.42
414 0.34
415 0.26
416 0.19
417 0.15
418 0.11
419 0.09
420 0.09
421 0.08
422 0.08
423 0.06
424 0.06
425 0.06
426 0.06
427 0.06
428 0.06
429 0.06
430 0.06
431 0.06
432 0.07
433 0.08
434 0.11
435 0.11
436 0.11
437 0.12
438 0.12
439 0.12
440 0.16
441 0.17
442 0.16
443 0.21
444 0.25
445 0.27
446 0.28
447 0.27
448 0.28
449 0.3
450 0.35
451 0.34
452 0.38
453 0.4
454 0.48
455 0.54
456 0.59
457 0.63
458 0.68
459 0.74
460 0.74
461 0.79
462 0.78
463 0.79
464 0.79
465 0.78
466 0.73
467 0.66
468 0.61
469 0.52
470 0.46
471 0.4
472 0.31
473 0.23
474 0.19