Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2YBH7

Protein Details
Accession A0A0C2YBH7    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
58-79IGARVRCGKNGKKKKSGQQNRTHydrophilic
NLS Segment(s)
PositionSequence
68-72GKKKK
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 6, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MHGYGKLNNKMMIRMDKKGWIQIDNGGRNEDSSSRLKVNPNVLSEIVAPAEGFVAALIGARVRCGKNGKKKKSGQQNRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.41
3 0.43
4 0.44
5 0.46
6 0.43
7 0.34
8 0.31
9 0.33
10 0.38
11 0.36
12 0.36
13 0.31
14 0.29
15 0.28
16 0.28
17 0.22
18 0.17
19 0.16
20 0.17
21 0.18
22 0.2
23 0.22
24 0.25
25 0.3
26 0.3
27 0.28
28 0.28
29 0.26
30 0.24
31 0.22
32 0.19
33 0.13
34 0.09
35 0.07
36 0.05
37 0.05
38 0.04
39 0.04
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.04
46 0.04
47 0.06
48 0.1
49 0.11
50 0.16
51 0.24
52 0.34
53 0.44
54 0.55
55 0.64
56 0.7
57 0.78
58 0.84
59 0.87