Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3CGC1

Protein Details
Accession A0A0C3CGC1    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
57-82SFKMKGMRLRWRKRTHTWLRRRAGSGHydrophilic
NLS Segment(s)
PositionSequence
61-77KGMRLRWRKRTHTWLRR
Subcellular Location(s) mito 18, mito_nucl 13, nucl 6
Family & Domain DBs
Amino Acid Sequences MKAFRRFRRRLVSTRFGNSFRCALRGWSRWFWAMIMRSAYRMRGWLCRNPCARLWRSFKMKGMRLRWRKRTHTWLRRRAGSGSTFRIEVRIVVPRSLVLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.72
3 0.64
4 0.59
5 0.52
6 0.48
7 0.39
8 0.34
9 0.28
10 0.28
11 0.33
12 0.36
13 0.4
14 0.39
15 0.4
16 0.39
17 0.39
18 0.34
19 0.31
20 0.26
21 0.22
22 0.22
23 0.2
24 0.21
25 0.22
26 0.22
27 0.18
28 0.19
29 0.18
30 0.22
31 0.25
32 0.29
33 0.32
34 0.38
35 0.4
36 0.4
37 0.42
38 0.41
39 0.41
40 0.42
41 0.46
42 0.45
43 0.5
44 0.51
45 0.53
46 0.54
47 0.57
48 0.57
49 0.59
50 0.63
51 0.66
52 0.73
53 0.77
54 0.78
55 0.79
56 0.79
57 0.82
58 0.83
59 0.83
60 0.84
61 0.84
62 0.83
63 0.81
64 0.76
65 0.68
66 0.62
67 0.58
68 0.53
69 0.49
70 0.43
71 0.38
72 0.35
73 0.34
74 0.29
75 0.23
76 0.2
77 0.23
78 0.23
79 0.23
80 0.23