Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2Z8S2

Protein Details
Accession A0A0C2Z8S2   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
48-73SDPPARKDATRKDKGKKKQDANGPASHydrophilic
NLS Segment(s)
PositionSequence
53-66RKDATRKDKGKKKQ
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036882  Alba-like_dom_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MNSNKKRKIDSNDLDDSSKRHKTAQAEPAVLTEIPQTSEPQANDEGSSDPPARKDATRKDKGKKKQDANGPASGDQQPRRRINKLDPPRPFPVVPTSVSDTGPRSSHREGKNMICLTRKTSLGAYMRRCKDVILKDGYKTLHLSAMGAAIPLLLQLVAALPPILPFTQDEIHSEITTGTVEVQDEVIPDDEEEDITYQTRGKSVLRVVFKIGDGEFEGDRGAIRKYSAGKSIPKTFSKFGQKAGNKDIKGKNRVIEGQPPPTIFEEPEQEMMDML
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.57
3 0.52
4 0.49
5 0.47
6 0.4
7 0.36
8 0.39
9 0.42
10 0.51
11 0.56
12 0.55
13 0.51
14 0.5
15 0.47
16 0.45
17 0.38
18 0.29
19 0.21
20 0.14
21 0.14
22 0.14
23 0.15
24 0.15
25 0.21
26 0.2
27 0.22
28 0.23
29 0.22
30 0.22
31 0.21
32 0.2
33 0.16
34 0.2
35 0.19
36 0.18
37 0.18
38 0.21
39 0.22
40 0.24
41 0.32
42 0.38
43 0.47
44 0.56
45 0.63
46 0.71
47 0.78
48 0.84
49 0.86
50 0.86
51 0.83
52 0.81
53 0.83
54 0.83
55 0.78
56 0.74
57 0.66
58 0.56
59 0.51
60 0.48
61 0.43
62 0.4
63 0.42
64 0.44
65 0.5
66 0.54
67 0.56
68 0.57
69 0.6
70 0.65
71 0.68
72 0.69
73 0.67
74 0.68
75 0.68
76 0.66
77 0.57
78 0.48
79 0.43
80 0.37
81 0.32
82 0.29
83 0.29
84 0.26
85 0.27
86 0.26
87 0.22
88 0.21
89 0.21
90 0.2
91 0.21
92 0.23
93 0.31
94 0.32
95 0.36
96 0.37
97 0.39
98 0.45
99 0.42
100 0.4
101 0.35
102 0.33
103 0.32
104 0.31
105 0.28
106 0.21
107 0.2
108 0.24
109 0.25
110 0.3
111 0.33
112 0.39
113 0.4
114 0.4
115 0.4
116 0.34
117 0.35
118 0.34
119 0.33
120 0.31
121 0.31
122 0.3
123 0.33
124 0.33
125 0.27
126 0.24
127 0.18
128 0.13
129 0.12
130 0.11
131 0.08
132 0.09
133 0.07
134 0.06
135 0.06
136 0.04
137 0.04
138 0.03
139 0.03
140 0.02
141 0.02
142 0.02
143 0.02
144 0.02
145 0.03
146 0.03
147 0.03
148 0.03
149 0.04
150 0.04
151 0.05
152 0.05
153 0.08
154 0.1
155 0.11
156 0.13
157 0.15
158 0.16
159 0.16
160 0.15
161 0.12
162 0.11
163 0.1
164 0.09
165 0.06
166 0.05
167 0.05
168 0.05
169 0.06
170 0.05
171 0.06
172 0.07
173 0.07
174 0.07
175 0.06
176 0.07
177 0.06
178 0.06
179 0.07
180 0.07
181 0.06
182 0.07
183 0.08
184 0.09
185 0.09
186 0.1
187 0.11
188 0.11
189 0.15
190 0.2
191 0.27
192 0.28
193 0.29
194 0.31
195 0.31
196 0.3
197 0.28
198 0.23
199 0.17
200 0.15
201 0.16
202 0.13
203 0.12
204 0.11
205 0.09
206 0.1
207 0.09
208 0.1
209 0.08
210 0.09
211 0.13
212 0.17
213 0.21
214 0.26
215 0.3
216 0.36
217 0.42
218 0.51
219 0.53
220 0.54
221 0.56
222 0.53
223 0.56
224 0.6
225 0.55
226 0.52
227 0.56
228 0.56
229 0.57
230 0.64
231 0.64
232 0.55
233 0.62
234 0.65
235 0.64
236 0.66
237 0.64
238 0.58
239 0.56
240 0.62
241 0.57
242 0.58
243 0.55
244 0.55
245 0.55
246 0.51
247 0.47
248 0.44
249 0.41
250 0.33
251 0.3
252 0.28
253 0.27
254 0.3
255 0.29