Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3CRJ3

Protein Details
Accession A0A0C3CRJ3   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
28-49STTPSALSRPKRKQVKMACTNCHydrophilic
74-100CVDGQRKERKKGVKRGPYKRKSKGESDBasic
NLS Segment(s)
PositionSequence
79-96RKERKKGVKRGPYKRKSK
237-256GGKKRSRAGKNGEPKAKKAK
Subcellular Location(s) mito 12, cyto 11, cyto_nucl 8, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MIGLPPGVVYAYPPHHQGPPFSPPPSTSTTPSALSRPKRKQVKMACTNCAGACKRCDEQRPCERCVKYGITDTCVDGQRKERKKGVKRGPYKRKSKGESDGGFTGSQPPSATTTSAAIHAVAQYAPEGYYPIYYPPGQYLPPPHEGPDGSPPHPNGQHIMPYYIHPGAYPPFPHYPPMYPPQSGPPPPNAPHAHPPAPPPPVQPEQQPQTINPADAARKPDDPGPVVEKNGVETNGGGKKRSRAGKNGEPKAKKAKVSHAAAVAQAEKEKEEVVVIVEEQTAHDNNEDDSDNSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.3
3 0.32
4 0.35
5 0.35
6 0.39
7 0.43
8 0.42
9 0.41
10 0.37
11 0.4
12 0.42
13 0.4
14 0.35
15 0.34
16 0.35
17 0.37
18 0.37
19 0.39
20 0.41
21 0.47
22 0.53
23 0.58
24 0.65
25 0.72
26 0.75
27 0.78
28 0.8
29 0.82
30 0.82
31 0.79
32 0.75
33 0.67
34 0.65
35 0.56
36 0.53
37 0.45
38 0.39
39 0.35
40 0.35
41 0.35
42 0.39
43 0.48
44 0.48
45 0.54
46 0.61
47 0.63
48 0.63
49 0.68
50 0.63
51 0.55
52 0.55
53 0.49
54 0.41
55 0.45
56 0.42
57 0.36
58 0.36
59 0.35
60 0.34
61 0.34
62 0.32
63 0.26
64 0.32
65 0.39
66 0.46
67 0.51
68 0.53
69 0.59
70 0.68
71 0.76
72 0.78
73 0.78
74 0.81
75 0.86
76 0.9
77 0.89
78 0.9
79 0.89
80 0.88
81 0.82
82 0.79
83 0.76
84 0.75
85 0.67
86 0.62
87 0.53
88 0.45
89 0.4
90 0.33
91 0.3
92 0.2
93 0.19
94 0.14
95 0.14
96 0.14
97 0.15
98 0.16
99 0.11
100 0.12
101 0.12
102 0.13
103 0.12
104 0.09
105 0.09
106 0.08
107 0.08
108 0.06
109 0.06
110 0.05
111 0.05
112 0.05
113 0.04
114 0.05
115 0.04
116 0.05
117 0.05
118 0.06
119 0.09
120 0.09
121 0.09
122 0.1
123 0.12
124 0.12
125 0.13
126 0.15
127 0.17
128 0.21
129 0.21
130 0.2
131 0.2
132 0.2
133 0.2
134 0.25
135 0.25
136 0.22
137 0.24
138 0.23
139 0.26
140 0.26
141 0.25
142 0.19
143 0.16
144 0.19
145 0.18
146 0.19
147 0.16
148 0.16
149 0.18
150 0.17
151 0.16
152 0.11
153 0.12
154 0.12
155 0.13
156 0.13
157 0.14
158 0.17
159 0.18
160 0.2
161 0.21
162 0.21
163 0.24
164 0.29
165 0.28
166 0.25
167 0.26
168 0.3
169 0.34
170 0.35
171 0.33
172 0.33
173 0.35
174 0.36
175 0.43
176 0.39
177 0.37
178 0.42
179 0.46
180 0.44
181 0.39
182 0.42
183 0.4
184 0.41
185 0.38
186 0.33
187 0.33
188 0.33
189 0.34
190 0.35
191 0.36
192 0.37
193 0.41
194 0.4
195 0.34
196 0.38
197 0.37
198 0.32
199 0.26
200 0.25
201 0.22
202 0.24
203 0.28
204 0.23
205 0.23
206 0.25
207 0.27
208 0.27
209 0.27
210 0.27
211 0.29
212 0.28
213 0.28
214 0.29
215 0.25
216 0.24
217 0.25
218 0.22
219 0.16
220 0.14
221 0.19
222 0.23
223 0.24
224 0.24
225 0.24
226 0.29
227 0.36
228 0.45
229 0.44
230 0.46
231 0.54
232 0.63
233 0.71
234 0.75
235 0.78
236 0.73
237 0.73
238 0.75
239 0.72
240 0.69
241 0.63
242 0.64
243 0.63
244 0.65
245 0.64
246 0.57
247 0.53
248 0.47
249 0.44
250 0.35
251 0.27
252 0.24
253 0.2
254 0.16
255 0.15
256 0.15
257 0.12
258 0.11
259 0.1
260 0.1
261 0.11
262 0.1
263 0.1
264 0.1
265 0.1
266 0.11
267 0.14
268 0.13
269 0.13
270 0.14
271 0.14
272 0.14
273 0.17
274 0.18