Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2XC68

Protein Details
Accession A0A0C2XC68   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
121-146HDIATIPTRSRNKKKKRAGVNVMSGFHydrophilic
NLS Segment(s)
PositionSequence
130-137SRNKKKKR
Subcellular Location(s) cysk 21, nucl 4.5, cyto_nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019103  Peptidase_aspartic_DDI1-type  
IPR021109  Peptidase_aspartic_dom_sf  
Gene Ontology GO:0004190  F:aspartic-type endopeptidase activity  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF09668  Asp_protease  
CDD cd00303  retropepsin_like  
Amino Acid Sequences MEDLKVIDVEIEGVKIEAILDEGCQIITMRQDIWEKTGLPLRTDHNLTMESANMSTDSTMGLLHNVPMTVGGFQFLVQIQVTESASYEMLLGRPFHAHAEVLTKHFQNGDAHITIKDPITHDIATIPTRSRNKKKKRAGVNVMSGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.06
4 0.04
5 0.05
6 0.05
7 0.05
8 0.06
9 0.06
10 0.06
11 0.06
12 0.07
13 0.06
14 0.08
15 0.09
16 0.09
17 0.12
18 0.16
19 0.16
20 0.19
21 0.21
22 0.2
23 0.21
24 0.27
25 0.24
26 0.22
27 0.24
28 0.24
29 0.26
30 0.27
31 0.25
32 0.21
33 0.21
34 0.21
35 0.19
36 0.17
37 0.12
38 0.1
39 0.1
40 0.08
41 0.07
42 0.06
43 0.05
44 0.05
45 0.04
46 0.04
47 0.04
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.04
58 0.05
59 0.04
60 0.04
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.05
67 0.06
68 0.06
69 0.06
70 0.06
71 0.06
72 0.06
73 0.06
74 0.06
75 0.05
76 0.06
77 0.07
78 0.07
79 0.07
80 0.08
81 0.08
82 0.09
83 0.1
84 0.09
85 0.08
86 0.14
87 0.15
88 0.17
89 0.19
90 0.19
91 0.18
92 0.19
93 0.21
94 0.17
95 0.18
96 0.2
97 0.18
98 0.19
99 0.19
100 0.19
101 0.18
102 0.17
103 0.16
104 0.14
105 0.15
106 0.18
107 0.17
108 0.17
109 0.17
110 0.19
111 0.19
112 0.19
113 0.19
114 0.24
115 0.32
116 0.42
117 0.52
118 0.6
119 0.69
120 0.78
121 0.87
122 0.88
123 0.91
124 0.92
125 0.92
126 0.9