Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2JHL0

Protein Details
Accession A0A0D2JHL0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
96-117ELSRWSEIRRRNRLTTRPGTREHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 6cyto 6cyto_mito 6, extr 5, pero 3, E.R. 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAVTQSLKFVFGAVATGIGGRVERRYGGMQAAGIVAGVLLALTLLLAVVLFRRQSVQMIPVRQDHGVAEEKEEWEPVILGEPSGLTRKINILEAGELSRWSEIRRRNRLTTRPGTREV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.07
4 0.06
5 0.06
6 0.07
7 0.06
8 0.08
9 0.09
10 0.09
11 0.12
12 0.14
13 0.15
14 0.16
15 0.16
16 0.14
17 0.14
18 0.13
19 0.1
20 0.08
21 0.06
22 0.04
23 0.03
24 0.03
25 0.02
26 0.01
27 0.01
28 0.01
29 0.01
30 0.01
31 0.01
32 0.01
33 0.01
34 0.02
35 0.02
36 0.03
37 0.04
38 0.04
39 0.05
40 0.06
41 0.07
42 0.08
43 0.13
44 0.16
45 0.18
46 0.2
47 0.21
48 0.22
49 0.21
50 0.2
51 0.15
52 0.14
53 0.17
54 0.15
55 0.16
56 0.15
57 0.16
58 0.16
59 0.16
60 0.13
61 0.09
62 0.09
63 0.06
64 0.08
65 0.07
66 0.06
67 0.06
68 0.07
69 0.08
70 0.1
71 0.1
72 0.08
73 0.09
74 0.12
75 0.13
76 0.15
77 0.15
78 0.14
79 0.15
80 0.16
81 0.17
82 0.15
83 0.13
84 0.12
85 0.12
86 0.12
87 0.13
88 0.18
89 0.26
90 0.36
91 0.46
92 0.53
93 0.61
94 0.71
95 0.77
96 0.81
97 0.83
98 0.82