Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2KA54

Protein Details
Accession A0A0D2KA54   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
67-92ISPSPFQPSRRESKKRKGDKCKSKMRBasic
NLS Segment(s)
PositionSequence
76-92RRESKKRKGDKCKSKMR
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR023391  Prot_translocase_SecE_dom_sf  
IPR008158  Translocase_Sec61-g  
IPR001901  Translocase_SecE/Sec61-g  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0008320  F:protein transmembrane transporter activity  
GO:0006605  P:protein targeting  
Pfam View protein in Pfam  
PF00584  SecE  
Amino Acid Sequences MSEILQEIADVPKEFFKDGTQFINRCTKPDRREFIKISQAVGMGFLIMGAIGYFIKLSASLPPPFPISPSPFQPSRRESKKRKGDKCKSKMR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.18
4 0.19
5 0.21
6 0.27
7 0.3
8 0.29
9 0.32
10 0.42
11 0.39
12 0.38
13 0.42
14 0.43
15 0.44
16 0.52
17 0.56
18 0.53
19 0.6
20 0.61
21 0.61
22 0.61
23 0.55
24 0.47
25 0.4
26 0.34
27 0.26
28 0.22
29 0.16
30 0.07
31 0.06
32 0.04
33 0.03
34 0.02
35 0.02
36 0.02
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.03
43 0.03
44 0.04
45 0.07
46 0.11
47 0.13
48 0.14
49 0.16
50 0.19
51 0.19
52 0.2
53 0.21
54 0.23
55 0.25
56 0.29
57 0.33
58 0.36
59 0.4
60 0.45
61 0.47
62 0.51
63 0.58
64 0.64
65 0.68
66 0.74
67 0.81
68 0.84
69 0.89
70 0.91
71 0.91
72 0.92