Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2J3U2

Protein Details
Accession A0A0D2J3U2    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
72-98NVYAHRRLPKLHHRPERRKFNILRPWWHydrophilic
NLS Segment(s)
PositionSequence
85-86RP
Subcellular Location(s) mito 16.5, mito_nucl 11.5, nucl 5.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039744  40S_S29/30S_S14z  
IPR001209  Ribosomal_S14  
IPR043140  Ribosomal_S14/S29  
IPR018271  Ribosomal_S14_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0008270  F:zinc ion binding  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00253  Ribosomal_S14  
PROSITE View protein in PROSITE  
PS00527  RIBOSOMAL_S14  
Amino Acid Sequences MSHESVWYSRPRNFGKGSRSCRVCTHKAGLIRKYGLNICRQCFREKSQDIGFIKNVFWLTMGIPFVKTAPINVYAHRRLPKLHHRPERRKFNILRPWWNEMWFGELLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.58
3 0.63
4 0.66
5 0.67
6 0.66
7 0.62
8 0.64
9 0.65
10 0.6
11 0.56
12 0.53
13 0.49
14 0.52
15 0.57
16 0.52
17 0.49
18 0.46
19 0.41
20 0.39
21 0.39
22 0.34
23 0.36
24 0.37
25 0.34
26 0.38
27 0.39
28 0.4
29 0.39
30 0.41
31 0.42
32 0.39
33 0.42
34 0.38
35 0.44
36 0.41
37 0.4
38 0.36
39 0.27
40 0.25
41 0.22
42 0.19
43 0.11
44 0.1
45 0.08
46 0.07
47 0.09
48 0.09
49 0.08
50 0.08
51 0.08
52 0.08
53 0.09
54 0.09
55 0.07
56 0.09
57 0.13
58 0.14
59 0.17
60 0.23
61 0.25
62 0.31
63 0.34
64 0.33
65 0.32
66 0.4
67 0.48
68 0.52
69 0.6
70 0.64
71 0.71
72 0.81
73 0.89
74 0.92
75 0.87
76 0.86
77 0.81
78 0.81
79 0.81
80 0.78
81 0.78
82 0.73
83 0.73
84 0.66
85 0.62
86 0.54
87 0.44
88 0.4