Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2JWC7

Protein Details
Accession A0A0D2JWC7    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
319-346TLASEKPPPKVTKKRGRKKQENVSTGGTHydrophilic
NLS Segment(s)
PositionSequence
324-337KPPPKVTKKRGRKK
Subcellular Location(s) cyto 18, cyto_nucl 15.333, nucl 8.5, mito_nucl 5.332
Family & Domain DBs
InterPro View protein in InterPro  
IPR011333  SKP1/BTB/POZ_sf  
CDD cd18186  BTB_POZ_ZBTB_KLHL-like  
Amino Acid Sequences MAVTQSDLRTFASALTKERQPDFDIIVKDFRWSVHSHVISSHGSFRKICRDAPENGKGRHEVHLDDDEPVIIAHLILWLYTEEYDDENMSEIAGFDVKSLLKHGKVSPPSIVHAPDRAGSGPAAGVNGAREETDIDCCADELPPISLHAKMYLVAHKYGITDLSEKAVYEITEILGAVKEALLPCLAHFFVTDSSPALDLDSMMVDVDHGNKRSILPRTTTNGEKEFGATTTNTPTATTGLSSKNCSPPAAKYRHAISEHQDPELWKVLAETTSQHFLSYHTDPQFQRIITCNPRFHWAVMSRVAGMLEAAQDQLAKSTLASEKPPPKVTKKRGRKKQENVSTGGTTTPSNSSEPAAAAAGEEEDNKNKGKESATAAGVHAPKKLKKDQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.31
3 0.34
4 0.38
5 0.41
6 0.41
7 0.37
8 0.38
9 0.38
10 0.39
11 0.38
12 0.36
13 0.37
14 0.34
15 0.32
16 0.3
17 0.26
18 0.23
19 0.22
20 0.25
21 0.3
22 0.32
23 0.3
24 0.31
25 0.34
26 0.33
27 0.33
28 0.36
29 0.3
30 0.31
31 0.32
32 0.35
33 0.41
34 0.42
35 0.43
36 0.42
37 0.43
38 0.48
39 0.55
40 0.6
41 0.58
42 0.57
43 0.58
44 0.54
45 0.51
46 0.5
47 0.43
48 0.35
49 0.32
50 0.35
51 0.32
52 0.29
53 0.27
54 0.21
55 0.19
56 0.17
57 0.13
58 0.07
59 0.06
60 0.04
61 0.06
62 0.05
63 0.05
64 0.06
65 0.06
66 0.07
67 0.07
68 0.07
69 0.07
70 0.08
71 0.1
72 0.09
73 0.09
74 0.09
75 0.09
76 0.08
77 0.07
78 0.06
79 0.06
80 0.07
81 0.06
82 0.05
83 0.07
84 0.08
85 0.08
86 0.11
87 0.14
88 0.15
89 0.19
90 0.22
91 0.28
92 0.32
93 0.34
94 0.36
95 0.34
96 0.35
97 0.34
98 0.33
99 0.27
100 0.25
101 0.24
102 0.2
103 0.2
104 0.18
105 0.16
106 0.13
107 0.12
108 0.1
109 0.09
110 0.08
111 0.06
112 0.06
113 0.05
114 0.06
115 0.06
116 0.05
117 0.05
118 0.07
119 0.08
120 0.09
121 0.1
122 0.09
123 0.09
124 0.09
125 0.1
126 0.08
127 0.08
128 0.07
129 0.07
130 0.07
131 0.09
132 0.09
133 0.1
134 0.1
135 0.1
136 0.1
137 0.1
138 0.11
139 0.14
140 0.15
141 0.15
142 0.15
143 0.14
144 0.15
145 0.14
146 0.13
147 0.1
148 0.1
149 0.09
150 0.11
151 0.1
152 0.1
153 0.1
154 0.1
155 0.09
156 0.08
157 0.08
158 0.06
159 0.06
160 0.06
161 0.05
162 0.05
163 0.05
164 0.04
165 0.03
166 0.04
167 0.04
168 0.05
169 0.05
170 0.05
171 0.05
172 0.07
173 0.07
174 0.06
175 0.06
176 0.07
177 0.07
178 0.08
179 0.08
180 0.07
181 0.07
182 0.07
183 0.07
184 0.06
185 0.05
186 0.05
187 0.05
188 0.04
189 0.04
190 0.03
191 0.03
192 0.03
193 0.03
194 0.07
195 0.09
196 0.1
197 0.11
198 0.11
199 0.13
200 0.18
201 0.22
202 0.21
203 0.21
204 0.24
205 0.29
206 0.32
207 0.34
208 0.32
209 0.3
210 0.29
211 0.26
212 0.23
213 0.19
214 0.16
215 0.14
216 0.11
217 0.1
218 0.12
219 0.13
220 0.12
221 0.11
222 0.11
223 0.11
224 0.11
225 0.1
226 0.1
227 0.14
228 0.15
229 0.18
230 0.21
231 0.25
232 0.26
233 0.27
234 0.26
235 0.28
236 0.36
237 0.39
238 0.38
239 0.36
240 0.39
241 0.44
242 0.45
243 0.4
244 0.36
245 0.4
246 0.39
247 0.37
248 0.35
249 0.28
250 0.29
251 0.32
252 0.27
253 0.16
254 0.15
255 0.16
256 0.15
257 0.15
258 0.14
259 0.12
260 0.16
261 0.16
262 0.15
263 0.14
264 0.15
265 0.2
266 0.21
267 0.25
268 0.24
269 0.3
270 0.3
271 0.34
272 0.36
273 0.31
274 0.3
275 0.28
276 0.33
277 0.37
278 0.44
279 0.43
280 0.41
281 0.46
282 0.45
283 0.42
284 0.42
285 0.35
286 0.33
287 0.33
288 0.33
289 0.28
290 0.27
291 0.26
292 0.18
293 0.15
294 0.1
295 0.07
296 0.06
297 0.06
298 0.06
299 0.06
300 0.06
301 0.07
302 0.07
303 0.07
304 0.06
305 0.1
306 0.14
307 0.16
308 0.19
309 0.27
310 0.34
311 0.4
312 0.48
313 0.5
314 0.57
315 0.65
316 0.73
317 0.75
318 0.79
319 0.84
320 0.88
321 0.93
322 0.94
323 0.93
324 0.94
325 0.93
326 0.88
327 0.82
328 0.77
329 0.67
330 0.56
331 0.47
332 0.37
333 0.26
334 0.23
335 0.21
336 0.17
337 0.17
338 0.17
339 0.18
340 0.18
341 0.18
342 0.17
343 0.14
344 0.12
345 0.11
346 0.1
347 0.1
348 0.09
349 0.11
350 0.12
351 0.15
352 0.17
353 0.19
354 0.2
355 0.21
356 0.24
357 0.24
358 0.27
359 0.31
360 0.35
361 0.35
362 0.36
363 0.35
364 0.38
365 0.4
366 0.36
367 0.34
368 0.35
369 0.37
370 0.43