Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2K7S5

Protein Details
Accession A0A0D2K7S5    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
8-36APAASSGGKKQKKKWSKGKVKDKANHAVVHydrophilic
NLS Segment(s)
PositionSequence
14-30GGKKQKKKWSKGKVKDK
Subcellular Location(s) cyto 18, mito 5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MVCASIPAPAASSGGKKQKKKWSKGKVKDKANHAVVLDKATSDKLNKDVQSYRLITVAVLVDRLKINGSLARKALADLEERGVIRKVVAHSKGSIYTRAAAGGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.38
3 0.42
4 0.51
5 0.61
6 0.69
7 0.76
8 0.8
9 0.82
10 0.85
11 0.9
12 0.93
13 0.91
14 0.91
15 0.87
16 0.84
17 0.81
18 0.73
19 0.64
20 0.54
21 0.47
22 0.37
23 0.32
24 0.25
25 0.16
26 0.13
27 0.12
28 0.13
29 0.11
30 0.12
31 0.13
32 0.18
33 0.19
34 0.22
35 0.23
36 0.25
37 0.28
38 0.28
39 0.25
40 0.21
41 0.2
42 0.16
43 0.15
44 0.13
45 0.08
46 0.07
47 0.07
48 0.07
49 0.07
50 0.08
51 0.07
52 0.07
53 0.08
54 0.11
55 0.13
56 0.15
57 0.15
58 0.16
59 0.16
60 0.16
61 0.17
62 0.15
63 0.15
64 0.13
65 0.15
66 0.16
67 0.16
68 0.18
69 0.17
70 0.15
71 0.13
72 0.16
73 0.17
74 0.24
75 0.27
76 0.28
77 0.29
78 0.32
79 0.37
80 0.36
81 0.36
82 0.29
83 0.28
84 0.26