Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2L4X0

Protein Details
Accession A0A0D2L4X0    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
24-44LSYNVYSRRHKRGKNIKVGDVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, cyto_nucl 9.333, mito 9, cyto 5.5, cyto_pero 4.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR036286  LexA/Signal_pep-like_sf  
IPR000223  Pept_S26A_signal_pept_1  
IPR019758  Pept_S26A_signal_pept_1_CS  
IPR019533  Peptidase_S26  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0004252  F:serine-type endopeptidase activity  
GO:0006465  P:signal peptide processing  
Pfam View protein in Pfam  
PF10502  Peptidase_S26  
PROSITE View protein in PROSITE  
PS00761  SPASE_I_3  
CDD cd06530  S26_SPase_I  
Amino Acid Sequences MGLGGTSLDHLRCPSMYPSMPSSLSYNVYSRRHKRGKNIKVGDVVVFESPIFLRGIACKRVIGMPGDYVLRDPHLSPTVGGAPIPGLYEGDAVREEPVMVQVPEGHVWVAGDNLSYSRDSRFYGPVPMALITGKTLYVGDGYFNWTSFRKPQLQTVTVSDDRSHAPVEREVALEDTQAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.23
3 0.25
4 0.27
5 0.3
6 0.32
7 0.33
8 0.31
9 0.31
10 0.27
11 0.27
12 0.26
13 0.26
14 0.29
15 0.36
16 0.44
17 0.48
18 0.56
19 0.62
20 0.65
21 0.72
22 0.76
23 0.79
24 0.81
25 0.8
26 0.74
27 0.7
28 0.66
29 0.56
30 0.46
31 0.37
32 0.26
33 0.2
34 0.14
35 0.1
36 0.09
37 0.09
38 0.08
39 0.06
40 0.07
41 0.11
42 0.16
43 0.18
44 0.18
45 0.17
46 0.18
47 0.2
48 0.2
49 0.18
50 0.14
51 0.12
52 0.13
53 0.13
54 0.12
55 0.11
56 0.1
57 0.09
58 0.09
59 0.09
60 0.1
61 0.12
62 0.12
63 0.12
64 0.13
65 0.13
66 0.12
67 0.12
68 0.09
69 0.07
70 0.07
71 0.07
72 0.05
73 0.04
74 0.04
75 0.05
76 0.05
77 0.06
78 0.05
79 0.05
80 0.06
81 0.06
82 0.05
83 0.04
84 0.06
85 0.06
86 0.06
87 0.06
88 0.06
89 0.07
90 0.08
91 0.08
92 0.07
93 0.05
94 0.05
95 0.05
96 0.05
97 0.04
98 0.04
99 0.04
100 0.04
101 0.06
102 0.06
103 0.07
104 0.08
105 0.1
106 0.11
107 0.14
108 0.17
109 0.17
110 0.2
111 0.2
112 0.2
113 0.19
114 0.18
115 0.16
116 0.13
117 0.12
118 0.09
119 0.09
120 0.07
121 0.06
122 0.06
123 0.06
124 0.07
125 0.06
126 0.07
127 0.07
128 0.12
129 0.12
130 0.12
131 0.14
132 0.14
133 0.17
134 0.21
135 0.27
136 0.31
137 0.32
138 0.4
139 0.47
140 0.49
141 0.49
142 0.48
143 0.5
144 0.44
145 0.44
146 0.36
147 0.3
148 0.29
149 0.28
150 0.25
151 0.2
152 0.21
153 0.23
154 0.25
155 0.25
156 0.24
157 0.23
158 0.24
159 0.22