Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2KIY5

Protein Details
Accession A0A0D2KIY5    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
78-113RGGKVSQRQIRRFQRRKQLKTQKPAKPKPAIPRTTRHydrophilic
NLS Segment(s)
PositionSequence
84-117QRQIRRFQRRKQLKTQKPAKPKPAIPRTTRSRST
Subcellular Location(s) mito 15, nucl 8.5, cyto_nucl 6.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025676  Clr5_dom  
Pfam View protein in Pfam  
PF14420  Clr5  
Amino Acid Sequences MVRSNHSRPIPTQIWEKHKFTIYELYARLPLDQVMAEMQQKHDFAATAQQYKRQLGKWGLRKNVLTELDVIDNESIARGGKVSQRQIRRFQRRKQLKTQKPAKPKPAIPRTTRSRSTQKRVAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.58
3 0.58
4 0.54
5 0.55
6 0.52
7 0.46
8 0.47
9 0.4
10 0.39
11 0.37
12 0.34
13 0.32
14 0.31
15 0.29
16 0.2
17 0.17
18 0.12
19 0.11
20 0.09
21 0.08
22 0.09
23 0.11
24 0.11
25 0.12
26 0.14
27 0.14
28 0.14
29 0.13
30 0.12
31 0.1
32 0.17
33 0.18
34 0.22
35 0.22
36 0.26
37 0.28
38 0.31
39 0.33
40 0.27
41 0.3
42 0.3
43 0.38
44 0.43
45 0.47
46 0.48
47 0.49
48 0.48
49 0.44
50 0.43
51 0.36
52 0.28
53 0.22
54 0.19
55 0.17
56 0.17
57 0.15
58 0.09
59 0.07
60 0.07
61 0.06
62 0.05
63 0.04
64 0.04
65 0.04
66 0.06
67 0.11
68 0.16
69 0.24
70 0.31
71 0.4
72 0.46
73 0.56
74 0.65
75 0.72
76 0.76
77 0.77
78 0.81
79 0.83
80 0.85
81 0.87
82 0.87
83 0.85
84 0.87
85 0.89
86 0.87
87 0.87
88 0.89
89 0.87
90 0.85
91 0.83
92 0.83
93 0.83
94 0.82
95 0.77
96 0.77
97 0.77
98 0.77
99 0.75
100 0.72
101 0.73
102 0.75
103 0.78