Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2IJC2

Protein Details
Accession A0A0D2IJC2    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
6-31LRPWLPTSALRRRPHFRRPYAIHSPGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 5, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR029063  SAM-dependent_MTases_sf  
Pfam View protein in Pfam  
PF13489  Methyltransf_23  
Amino Acid Sequences MKPPALRPWLPTSALRRRPHFRRPYAIHSPGAPTLQIFNENVKYLQKERAAANAEYSRKVDYLKDEVAQRLVDRLLDINREFPRVLDLGANSCNIARALSKPPLIAPELPEGAADAKVPLSERIHHLTCADTSPTALHRDDSLPAPAVPISQEVLPSLETLPYETNTFDAVVSSLSLHWINDLPSVLSSINNILKPDAPFLAAMFGGDTLFELRSSLQLADLERHGGVSPHISPLADVRDVGNLLGRAGFKLLTVDVDDIIVEYPDTFALMTDIQAMGEGNAILKSMGGPMSRDVLLANEAIYRELHCKEDEKDRIPATFRVIYMIGWKAGQGQPQPLERGSGNVNMKDILGGGEFM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.66
3 0.66
4 0.7
5 0.75
6 0.8
7 0.81
8 0.79
9 0.8
10 0.8
11 0.82
12 0.82
13 0.79
14 0.71
15 0.62
16 0.58
17 0.5
18 0.44
19 0.34
20 0.25
21 0.22
22 0.21
23 0.22
24 0.19
25 0.21
26 0.22
27 0.24
28 0.24
29 0.25
30 0.28
31 0.28
32 0.34
33 0.33
34 0.34
35 0.34
36 0.4
37 0.41
38 0.37
39 0.4
40 0.4
41 0.39
42 0.37
43 0.37
44 0.32
45 0.27
46 0.28
47 0.25
48 0.23
49 0.27
50 0.27
51 0.3
52 0.31
53 0.32
54 0.32
55 0.3
56 0.25
57 0.21
58 0.19
59 0.16
60 0.13
61 0.15
62 0.15
63 0.19
64 0.19
65 0.23
66 0.24
67 0.27
68 0.26
69 0.23
70 0.24
71 0.2
72 0.2
73 0.16
74 0.15
75 0.15
76 0.17
77 0.17
78 0.13
79 0.13
80 0.13
81 0.11
82 0.1
83 0.09
84 0.11
85 0.16
86 0.21
87 0.22
88 0.22
89 0.22
90 0.24
91 0.26
92 0.24
93 0.21
94 0.2
95 0.2
96 0.19
97 0.18
98 0.16
99 0.14
100 0.13
101 0.1
102 0.06
103 0.06
104 0.06
105 0.07
106 0.1
107 0.1
108 0.12
109 0.16
110 0.21
111 0.22
112 0.22
113 0.22
114 0.2
115 0.2
116 0.19
117 0.17
118 0.11
119 0.1
120 0.11
121 0.12
122 0.14
123 0.14
124 0.12
125 0.13
126 0.14
127 0.15
128 0.16
129 0.15
130 0.13
131 0.13
132 0.13
133 0.11
134 0.1
135 0.09
136 0.08
137 0.08
138 0.07
139 0.07
140 0.06
141 0.07
142 0.07
143 0.07
144 0.07
145 0.07
146 0.06
147 0.07
148 0.08
149 0.08
150 0.09
151 0.08
152 0.08
153 0.08
154 0.08
155 0.07
156 0.06
157 0.06
158 0.05
159 0.05
160 0.05
161 0.04
162 0.05
163 0.05
164 0.05
165 0.06
166 0.06
167 0.07
168 0.07
169 0.07
170 0.06
171 0.06
172 0.08
173 0.07
174 0.07
175 0.06
176 0.08
177 0.11
178 0.11
179 0.12
180 0.11
181 0.13
182 0.14
183 0.15
184 0.12
185 0.1
186 0.1
187 0.09
188 0.1
189 0.07
190 0.07
191 0.05
192 0.05
193 0.04
194 0.04
195 0.04
196 0.04
197 0.04
198 0.04
199 0.05
200 0.05
201 0.06
202 0.07
203 0.07
204 0.07
205 0.08
206 0.09
207 0.1
208 0.1
209 0.11
210 0.1
211 0.1
212 0.09
213 0.08
214 0.08
215 0.09
216 0.09
217 0.1
218 0.1
219 0.1
220 0.1
221 0.12
222 0.14
223 0.12
224 0.11
225 0.1
226 0.12
227 0.12
228 0.12
229 0.12
230 0.09
231 0.09
232 0.1
233 0.1
234 0.09
235 0.09
236 0.09
237 0.07
238 0.08
239 0.08
240 0.07
241 0.08
242 0.08
243 0.08
244 0.08
245 0.07
246 0.07
247 0.07
248 0.06
249 0.05
250 0.04
251 0.04
252 0.04
253 0.05
254 0.04
255 0.04
256 0.05
257 0.06
258 0.06
259 0.07
260 0.07
261 0.07
262 0.07
263 0.07
264 0.06
265 0.06
266 0.06
267 0.05
268 0.05
269 0.05
270 0.05
271 0.05
272 0.05
273 0.06
274 0.08
275 0.09
276 0.1
277 0.11
278 0.14
279 0.15
280 0.14
281 0.13
282 0.12
283 0.13
284 0.12
285 0.11
286 0.09
287 0.09
288 0.1
289 0.11
290 0.11
291 0.14
292 0.15
293 0.18
294 0.18
295 0.21
296 0.24
297 0.34
298 0.4
299 0.4
300 0.45
301 0.45
302 0.47
303 0.47
304 0.46
305 0.42
306 0.38
307 0.34
308 0.31
309 0.29
310 0.26
311 0.27
312 0.27
313 0.21
314 0.17
315 0.17
316 0.19
317 0.21
318 0.27
319 0.25
320 0.3
321 0.34
322 0.38
323 0.42
324 0.36
325 0.38
326 0.32
327 0.32
328 0.29
329 0.32
330 0.33
331 0.31
332 0.32
333 0.29
334 0.28
335 0.25
336 0.22
337 0.16