Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2K716

Protein Details
Accession A0A0D2K716   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
82-106SAAGNKKKEKAPKQPKQPKAPATPAHydrophilic
NLS Segment(s)
PositionSequence
86-101NKKKEKAPKQPKQPKA
Subcellular Location(s) cyto 13, mito 10.5, cyto_nucl 9.333, mito_nucl 7.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR002547  tRNA-bd_dom  
Gene Ontology GO:0000049  F:tRNA binding  
Pfam View protein in Pfam  
PF01588  tRNA_bind  
PROSITE View protein in PROSITE  
PS50886  TRBD  
Amino Acid Sequences MTSEVPSTSSSSTSAPAQHKPLVVGRTKPQSPATMDASSSSGGPVDKAIPAETKAALNHEIAENVKSNTSAPAPADETATPSAAGNKKKEKAPKQPKQPKAPATPAAPVSPALIDLRVGHILRAIAHPNADSLYVSTIAMGDPEGTEHTQVDEEKGKVVRTVCSGLNGLVPLEEMQNRKVVVVANLKPVNMRSIKSAAMVLAASPPAEEGADPHAADRVVELVNPPEGSEAGDKVYFEGWPYGEGKGPEKQLNPKKKVWESVQPGFFTSEELVVGFDAGRPGVEIEGDKEKKGWLIVEGKGKCTVQTLKGAVVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.28
3 0.32
4 0.36
5 0.38
6 0.38
7 0.39
8 0.42
9 0.42
10 0.42
11 0.42
12 0.44
13 0.49
14 0.5
15 0.51
16 0.49
17 0.48
18 0.47
19 0.47
20 0.45
21 0.38
22 0.36
23 0.33
24 0.31
25 0.26
26 0.21
27 0.16
28 0.12
29 0.1
30 0.1
31 0.1
32 0.1
33 0.11
34 0.12
35 0.13
36 0.14
37 0.15
38 0.17
39 0.17
40 0.17
41 0.16
42 0.19
43 0.19
44 0.17
45 0.17
46 0.16
47 0.16
48 0.16
49 0.17
50 0.16
51 0.15
52 0.15
53 0.14
54 0.13
55 0.14
56 0.15
57 0.15
58 0.13
59 0.15
60 0.17
61 0.17
62 0.19
63 0.16
64 0.18
65 0.17
66 0.17
67 0.14
68 0.12
69 0.18
70 0.21
71 0.26
72 0.29
73 0.36
74 0.4
75 0.46
76 0.56
77 0.59
78 0.65
79 0.71
80 0.74
81 0.78
82 0.84
83 0.88
84 0.88
85 0.87
86 0.84
87 0.8
88 0.78
89 0.71
90 0.63
91 0.58
92 0.49
93 0.41
94 0.34
95 0.26
96 0.2
97 0.15
98 0.13
99 0.09
100 0.08
101 0.07
102 0.07
103 0.08
104 0.1
105 0.1
106 0.09
107 0.1
108 0.1
109 0.11
110 0.13
111 0.13
112 0.1
113 0.11
114 0.11
115 0.1
116 0.1
117 0.1
118 0.08
119 0.06
120 0.07
121 0.07
122 0.06
123 0.06
124 0.06
125 0.05
126 0.05
127 0.05
128 0.04
129 0.03
130 0.04
131 0.05
132 0.05
133 0.06
134 0.06
135 0.06
136 0.07
137 0.07
138 0.09
139 0.11
140 0.11
141 0.13
142 0.14
143 0.13
144 0.14
145 0.15
146 0.14
147 0.14
148 0.16
149 0.14
150 0.15
151 0.15
152 0.13
153 0.13
154 0.12
155 0.09
156 0.07
157 0.07
158 0.05
159 0.06
160 0.08
161 0.09
162 0.09
163 0.12
164 0.12
165 0.12
166 0.12
167 0.12
168 0.14
169 0.2
170 0.21
171 0.27
172 0.27
173 0.27
174 0.27
175 0.26
176 0.27
177 0.21
178 0.2
179 0.16
180 0.18
181 0.19
182 0.19
183 0.19
184 0.14
185 0.12
186 0.12
187 0.08
188 0.07
189 0.07
190 0.06
191 0.05
192 0.05
193 0.05
194 0.05
195 0.04
196 0.04
197 0.08
198 0.1
199 0.1
200 0.1
201 0.11
202 0.11
203 0.11
204 0.1
205 0.09
206 0.07
207 0.08
208 0.08
209 0.08
210 0.1
211 0.1
212 0.1
213 0.08
214 0.08
215 0.1
216 0.1
217 0.1
218 0.1
219 0.11
220 0.11
221 0.11
222 0.11
223 0.1
224 0.1
225 0.11
226 0.09
227 0.11
228 0.12
229 0.12
230 0.14
231 0.16
232 0.18
233 0.21
234 0.25
235 0.28
236 0.3
237 0.4
238 0.47
239 0.56
240 0.6
241 0.6
242 0.66
243 0.67
244 0.71
245 0.66
246 0.67
247 0.65
248 0.67
249 0.66
250 0.58
251 0.53
252 0.47
253 0.41
254 0.33
255 0.25
256 0.17
257 0.12
258 0.12
259 0.11
260 0.08
261 0.09
262 0.07
263 0.07
264 0.07
265 0.06
266 0.06
267 0.06
268 0.07
269 0.07
270 0.08
271 0.08
272 0.11
273 0.22
274 0.23
275 0.23
276 0.23
277 0.24
278 0.25
279 0.26
280 0.23
281 0.19
282 0.24
283 0.29
284 0.38
285 0.38
286 0.39
287 0.42
288 0.41
289 0.35
290 0.36
291 0.36
292 0.31
293 0.37
294 0.37