Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2JZV9

Protein Details
Accession A0A0D2JZV9    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
309-331FAEKLAPERRKRLCREVRCEIMVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 8, cyto 5, extr 5, nucl 3, pero 3, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018524  DNA/RNA_endonuclease_AS  
IPR001604  DNA/RNA_non-sp_Endonuclease  
IPR044929  DNA/RNA_non-sp_Endonuclease_sf  
IPR020821  Extracellular_endonuc_su_A  
IPR044925  His-Me_finger_sf  
IPR040255  Non-specific_endonuclease  
Gene Ontology GO:0004519  F:endonuclease activity  
GO:0046872  F:metal ion binding  
GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF01223  Endonuclease_NS  
PROSITE View protein in PROSITE  
PS01070  NUCLEASE_NON_SPEC  
CDD cd00091  NUC  
Amino Acid Sequences MSKTTIAIIAATSAFAGASLTAFLLPGHRKDEPKPTPTLKETPTIPAQSTTPPAPVPVPVPVPVPVAVPAKPPPTAILPPVDPSGILRYGFPGPIADTLATPSHLSAFNRFTRNPHWVAEHFTAQSLLLNNGSRRNSVFYEDLSIPSMFRAKLSDYFRSGYDRGHQVPAADAKWSQEAMDSTFVLSNMCPQVGEGFNRDYWAHFEEFCRDLAKKFPSVRVVTGPLYLPKKDERDGKWRVSYEVIGNPPNVAVPTHFFKVIFAEEAALHPNGSVALGAFVLPNAEIPNSKSLSDFEVPLEAIERASGLVFAEKLAPERRKRLCREVRCEIMVREFDKSRQLANNIGPAPRNPPQVQQPGGKW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.04
5 0.04
6 0.05
7 0.05
8 0.05
9 0.06
10 0.06
11 0.12
12 0.15
13 0.18
14 0.23
15 0.27
16 0.31
17 0.36
18 0.47
19 0.5
20 0.51
21 0.56
22 0.57
23 0.6
24 0.63
25 0.65
26 0.57
27 0.54
28 0.52
29 0.49
30 0.5
31 0.45
32 0.4
33 0.34
34 0.33
35 0.31
36 0.33
37 0.29
38 0.25
39 0.22
40 0.22
41 0.21
42 0.21
43 0.19
44 0.19
45 0.2
46 0.18
47 0.2
48 0.19
49 0.21
50 0.19
51 0.18
52 0.18
53 0.18
54 0.18
55 0.2
56 0.22
57 0.23
58 0.23
59 0.23
60 0.21
61 0.24
62 0.26
63 0.25
64 0.25
65 0.23
66 0.25
67 0.25
68 0.23
69 0.17
70 0.16
71 0.18
72 0.16
73 0.15
74 0.13
75 0.15
76 0.16
77 0.17
78 0.15
79 0.12
80 0.11
81 0.12
82 0.13
83 0.11
84 0.09
85 0.11
86 0.12
87 0.12
88 0.11
89 0.1
90 0.1
91 0.13
92 0.14
93 0.16
94 0.21
95 0.26
96 0.3
97 0.31
98 0.32
99 0.34
100 0.4
101 0.38
102 0.35
103 0.34
104 0.3
105 0.36
106 0.35
107 0.33
108 0.27
109 0.25
110 0.23
111 0.18
112 0.19
113 0.13
114 0.11
115 0.1
116 0.12
117 0.13
118 0.18
119 0.19
120 0.18
121 0.18
122 0.21
123 0.2
124 0.22
125 0.22
126 0.17
127 0.21
128 0.2
129 0.2
130 0.19
131 0.17
132 0.14
133 0.13
134 0.15
135 0.1
136 0.1
137 0.11
138 0.1
139 0.17
140 0.21
141 0.24
142 0.24
143 0.26
144 0.26
145 0.29
146 0.28
147 0.22
148 0.22
149 0.23
150 0.23
151 0.23
152 0.23
153 0.18
154 0.19
155 0.21
156 0.17
157 0.13
158 0.11
159 0.11
160 0.11
161 0.11
162 0.09
163 0.08
164 0.08
165 0.09
166 0.1
167 0.09
168 0.09
169 0.09
170 0.09
171 0.08
172 0.07
173 0.08
174 0.08
175 0.07
176 0.07
177 0.06
178 0.09
179 0.1
180 0.11
181 0.11
182 0.12
183 0.12
184 0.13
185 0.14
186 0.12
187 0.13
188 0.15
189 0.13
190 0.13
191 0.13
192 0.16
193 0.17
194 0.17
195 0.16
196 0.14
197 0.14
198 0.19
199 0.21
200 0.24
201 0.25
202 0.28
203 0.33
204 0.34
205 0.35
206 0.32
207 0.33
208 0.27
209 0.27
210 0.23
211 0.22
212 0.23
213 0.21
214 0.21
215 0.22
216 0.25
217 0.28
218 0.34
219 0.35
220 0.41
221 0.47
222 0.51
223 0.52
224 0.49
225 0.47
226 0.41
227 0.38
228 0.32
229 0.31
230 0.28
231 0.24
232 0.23
233 0.22
234 0.19
235 0.18
236 0.15
237 0.1
238 0.08
239 0.1
240 0.14
241 0.15
242 0.16
243 0.15
244 0.15
245 0.17
246 0.18
247 0.15
248 0.11
249 0.11
250 0.11
251 0.12
252 0.14
253 0.11
254 0.1
255 0.08
256 0.08
257 0.07
258 0.07
259 0.06
260 0.04
261 0.04
262 0.04
263 0.05
264 0.04
265 0.04
266 0.05
267 0.04
268 0.05
269 0.05
270 0.06
271 0.07
272 0.09
273 0.15
274 0.16
275 0.17
276 0.17
277 0.17
278 0.22
279 0.23
280 0.22
281 0.17
282 0.18
283 0.18
284 0.17
285 0.17
286 0.12
287 0.1
288 0.09
289 0.08
290 0.06
291 0.06
292 0.07
293 0.05
294 0.07
295 0.07
296 0.07
297 0.1
298 0.1
299 0.14
300 0.22
301 0.3
302 0.34
303 0.44
304 0.53
305 0.6
306 0.67
307 0.75
308 0.77
309 0.8
310 0.83
311 0.83
312 0.8
313 0.75
314 0.72
315 0.63
316 0.6
317 0.55
318 0.48
319 0.44
320 0.39
321 0.37
322 0.4
323 0.39
324 0.37
325 0.39
326 0.4
327 0.4
328 0.42
329 0.48
330 0.43
331 0.45
332 0.42
333 0.37
334 0.41
335 0.41
336 0.45
337 0.39
338 0.43
339 0.49
340 0.56
341 0.59