Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2JT07

Protein Details
Accession A0A0D2JT07   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
15-43QEYNKRRAAWKESEKKRKQEEKLLRDQAKHydrophilic
NLS Segment(s)
PositionSequence
19-51KRRAAWKESEKKRKQEEKLLRDQAKRDRKAALK
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSVSPYSVQHDYEVQEYNKRRAAWKESEKKRKQEEKLLRDQAKRDRKAALKQLAEAERAEPRKTFGWLCRKSPSKTEVFAAKKLEDDSDSDEISLQAALAPELGKRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.31
3 0.34
4 0.38
5 0.4
6 0.39
7 0.41
8 0.43
9 0.49
10 0.51
11 0.57
12 0.63
13 0.68
14 0.78
15 0.81
16 0.83
17 0.85
18 0.85
19 0.8
20 0.8
21 0.8
22 0.77
23 0.8
24 0.81
25 0.77
26 0.7
27 0.7
28 0.69
29 0.68
30 0.63
31 0.54
32 0.51
33 0.49
34 0.53
35 0.56
36 0.54
37 0.44
38 0.43
39 0.46
40 0.41
41 0.37
42 0.3
43 0.23
44 0.2
45 0.21
46 0.21
47 0.16
48 0.17
49 0.17
50 0.2
51 0.21
52 0.23
53 0.32
54 0.36
55 0.39
56 0.45
57 0.5
58 0.5
59 0.53
60 0.51
61 0.45
62 0.43
63 0.43
64 0.44
65 0.42
66 0.43
67 0.41
68 0.36
69 0.33
70 0.32
71 0.3
72 0.22
73 0.2
74 0.22
75 0.21
76 0.21
77 0.19
78 0.19
79 0.17
80 0.16
81 0.14
82 0.08
83 0.06
84 0.06
85 0.06
86 0.07
87 0.07