Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2K8C1

Protein Details
Accession A0A0D2K8C1   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
44-63YFVFKEKRKHSIRRHSPEVLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 12.5, cyto 8, mito 2
Family & Domain DBs
Amino Acid Sequences MELRKVCQAIQLRAEDLVPAAEQTGVWRTPVNQVPNISAIKRVYFVFKEKRKHSIRRHSPEVLFFSEDTLTVQEDQFILIIWLENP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.27
3 0.2
4 0.15
5 0.1
6 0.07
7 0.06
8 0.06
9 0.06
10 0.07
11 0.1
12 0.09
13 0.1
14 0.1
15 0.11
16 0.18
17 0.23
18 0.25
19 0.25
20 0.26
21 0.26
22 0.29
23 0.3
24 0.23
25 0.21
26 0.18
27 0.16
28 0.16
29 0.15
30 0.14
31 0.15
32 0.2
33 0.27
34 0.33
35 0.4
36 0.42
37 0.51
38 0.56
39 0.65
40 0.69
41 0.71
42 0.76
43 0.76
44 0.81
45 0.77
46 0.72
47 0.67
48 0.61
49 0.52
50 0.43
51 0.34
52 0.29
53 0.23
54 0.2
55 0.16
56 0.13
57 0.11
58 0.11
59 0.11
60 0.1
61 0.1
62 0.1
63 0.09
64 0.08
65 0.07
66 0.06