FuNGI

A0A0D2H6E6

Protein Details

Accession

A0A0D2H6E6

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
312-334	ATFFWVRRRRKVRRAAEANRTTT	Hydrophilic

NLS Segment(s)

Position	Sequence
319-325	RRRKVRR

Subcellular Location(s)

extr 26

Family & Domain DBs

InterPro	View protein in InterPro IPR008427 Extracellular_membr_CFEM_dom
Gene Ontology	GO:0005886 C:plasma membrane
Pfam	View protein in Pfam PF05730 CFEM

Amino Acid Sequences

MKLVLTFLYHILCFRLVHAISVQDIPVCAQNCLSNSTSSQTSCAVIDLACLCTNSAYVSSLSCCLDTQCTSDEQALAIQFNKQECASVNETAPDFVGCSPAGLSSALASMSLSQTTPAAGTTSIPPASTSSSSSSNPSLTTLSGDPVSETADATTGKPVTVTAFVGAPLMTGSCTVPYFVITTDAAGMVTEYPNVGCSEDRPECCPYEYGLNAAITRCPQDYFTTASACCPLGYQIYYTAVGQNTPCYSSPATTFVPASTPTVAGLTLITNHVFSQKYSLVTPQPAKSKFPTGAKIAIPISIGVVICIICIATFFWVRRRRKVRRAAEANRTTTFPPEEPVLSQMSMSRAPTAHELDSPEAQAGSPGAVGVANGWPIFPTSSPPAYDQSKGVQAAIQKQPPSAPQELPGSTFIHEHHPVFSPTGSVSTPTEATPSSPPGTPVRAASAGAEKRSPVLSSPTSRSETRSPVFVSPLGSPRLPKTG

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.15
2	0.22
3	0.2
4	0.21
5	0.22
6	0.22
7	0.22
8	0.23
9	0.22
10	0.15
11	0.15
12	0.14
13	0.18
14	0.17
15	0.16
16	0.16
17	0.19
18	0.2
19	0.24
20	0.24
21	0.21
22	0.21
23	0.25
24	0.27
25	0.24
26	0.25
27	0.22
28	0.21
29	0.19
30	0.19
31	0.16
32	0.12
33	0.14
34	0.13
35	0.15
36	0.14
37	0.14
38	0.13
39	0.13
40	0.13
41	0.12
42	0.11
43	0.1
44	0.1
45	0.11
46	0.12
47	0.15
48	0.15
49	0.15
50	0.14
51	0.14
52	0.17
53	0.17
54	0.18
55	0.18
56	0.19
57	0.2
58	0.21
59	0.2
60	0.16
61	0.17
62	0.16
63	0.15
64	0.14
65	0.15
66	0.16
67	0.16
68	0.18
69	0.16
70	0.16
71	0.16
72	0.22
73	0.23
74	0.23
75	0.23
76	0.23
77	0.24
78	0.22
79	0.21
80	0.15
81	0.12
82	0.1
83	0.12
84	0.09
85	0.09
86	0.09
87	0.08
88	0.09
89	0.08
90	0.08
91	0.06
92	0.07
93	0.06
94	0.06
95	0.06
96	0.06
97	0.07
98	0.07
99	0.07
100	0.07
101	0.07
102	0.07
103	0.07
104	0.07
105	0.07
106	0.06
107	0.08
108	0.09
109	0.13
110	0.13
111	0.13
112	0.13
113	0.14
114	0.17
115	0.17
116	0.17
117	0.16
118	0.2
119	0.21
120	0.23
121	0.23
122	0.21
123	0.2
124	0.19
125	0.17
126	0.14
127	0.16
128	0.13
129	0.13
130	0.13
131	0.12
132	0.11
133	0.1
134	0.12
135	0.09
136	0.08
137	0.07
138	0.08
139	0.09
140	0.09
141	0.12
142	0.1
143	0.1
144	0.1
145	0.1
146	0.1
147	0.11
148	0.1
149	0.08
150	0.08
151	0.08
152	0.09
153	0.08
154	0.07
155	0.05
156	0.05
157	0.04
158	0.05
159	0.05
160	0.05
161	0.06
162	0.06
163	0.06
164	0.07
165	0.07
166	0.07
167	0.09
168	0.08
169	0.08
170	0.08
171	0.08
172	0.07
173	0.06
174	0.06
175	0.05
176	0.05
177	0.05
178	0.04
179	0.04
180	0.05
181	0.06
182	0.06
183	0.06
184	0.07
185	0.13
186	0.18
187	0.19
188	0.21
189	0.23
190	0.24
191	0.25
192	0.25
193	0.19
194	0.18
195	0.18
196	0.15
197	0.15
198	0.15
199	0.14
200	0.13
201	0.13
202	0.1
203	0.11
204	0.1
205	0.09
206	0.1
207	0.11
208	0.12
209	0.16
210	0.16
211	0.17
212	0.16
213	0.16
214	0.16
215	0.15
216	0.13
217	0.09
218	0.08
219	0.08
220	0.08
221	0.08
222	0.08
223	0.09
224	0.09
225	0.09
226	0.11
227	0.09
228	0.1
229	0.09
230	0.1
231	0.09
232	0.1
233	0.1
234	0.11
235	0.11
236	0.11
237	0.13
238	0.15
239	0.15
240	0.15
241	0.15
242	0.12
243	0.13
244	0.13
245	0.13
246	0.1
247	0.09
248	0.08
249	0.08
250	0.08
251	0.07
252	0.06
253	0.05
254	0.05
255	0.06
256	0.06
257	0.06
258	0.06
259	0.09
260	0.09
261	0.09
262	0.12
263	0.14
264	0.15
265	0.15
266	0.18
267	0.17
268	0.22
269	0.25
270	0.25
271	0.31
272	0.31
273	0.34
274	0.33
275	0.36
276	0.36
277	0.37
278	0.36
279	0.32
280	0.35
281	0.32
282	0.33
283	0.28
284	0.24
285	0.2
286	0.16
287	0.13
288	0.1
289	0.1
290	0.06
291	0.06
292	0.05
293	0.05
294	0.05
295	0.04
296	0.03
297	0.03
298	0.03
299	0.05
300	0.08
301	0.09
302	0.17
303	0.27
304	0.31
305	0.41
306	0.51
307	0.59
308	0.67
309	0.77
310	0.78
311	0.8
312	0.87
313	0.85
314	0.85
315	0.83
316	0.77
317	0.68
318	0.6
319	0.5
320	0.42
321	0.37
322	0.26
323	0.21
324	0.18
325	0.18
326	0.17
327	0.18
328	0.17
329	0.14
330	0.14
331	0.14
332	0.14
333	0.15
334	0.15
335	0.15
336	0.13
337	0.15
338	0.18
339	0.2
340	0.18
341	0.19
342	0.21
343	0.21
344	0.22
345	0.21
346	0.18
347	0.14
348	0.13
349	0.12
350	0.09
351	0.07
352	0.05
353	0.05
354	0.04
355	0.04
356	0.04
357	0.05
358	0.05
359	0.06
360	0.06
361	0.06
362	0.06
363	0.07
364	0.09
365	0.08
366	0.11
367	0.15
368	0.18
369	0.2
370	0.22
371	0.26
372	0.28
373	0.3
374	0.28
375	0.26
376	0.29
377	0.28
378	0.26
379	0.23
380	0.23
381	0.3
382	0.35
383	0.37
384	0.32
385	0.33
386	0.34
387	0.36
388	0.39
389	0.35
390	0.29
391	0.29
392	0.33
393	0.33
394	0.34
395	0.32
396	0.27
397	0.24
398	0.24
399	0.21
400	0.23
401	0.25
402	0.24
403	0.24
404	0.26
405	0.27
406	0.27
407	0.26
408	0.2
409	0.17
410	0.19
411	0.17
412	0.16
413	0.15
414	0.16
415	0.17
416	0.16
417	0.18
418	0.15
419	0.18
420	0.19
421	0.23
422	0.22
423	0.22
424	0.25
425	0.27
426	0.31
427	0.3
428	0.28
429	0.28
430	0.27
431	0.27
432	0.26
433	0.31
434	0.31
435	0.32
436	0.32
437	0.27
438	0.28
439	0.29
440	0.27
441	0.2
442	0.24
443	0.28
444	0.33
445	0.38
446	0.42
447	0.45
448	0.46
449	0.49
450	0.48
451	0.5
452	0.46
453	0.46
454	0.44
455	0.42
456	0.45
457	0.41
458	0.37
459	0.33
460	0.36
461	0.35
462	0.33
463	0.33

A0A0D2H6E6

3D AlphaFold-predicted Structure Viewer