Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2KCU7

Protein Details
Accession A0A0D2KCU7    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
432-473DEPAEEKRGRRHWRRHPNMHHEGDRRRWRDKVTERERKRYEGBasic
NLS Segment(s)
PositionSequence
371-383SKKVPPPIPRRRS
438-469KRGRRHWRRHPNMHHEGDRRRWRDKVTERERK
Subcellular Location(s) mito 15, nucl 8, cyto_nucl 6.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011992  EF-hand-dom_pair  
IPR000261  EH_dom  
PROSITE View protein in PROSITE  
PS50031  EH  
CDD cd00052  EH  
Amino Acid Sequences MSEKQARRPPVAPKPSFIQQHNAATAKLSPLPSPALQGATLAFGPPAVKPPNVSVSASHNPSAGALLAATTASIRKQQQRQNEGPSQEPAINPRGRALTTERLPVAISDYSSLSPPKPGLRPHPPRSTSAVAAVVASARTSPVRRPELKRDLASSYLARRDPSQVRTRGMSTSSSSETVQSLPQSAAALAGAQASMTTAPVQVQTATGDKHRSDLSYLSNLPLYSVQASSAPSPSLSGAAAAATASRNAASLEARRRALSTSEESSPSAPVFRNLTASPQSTTGSSWPRLRVTPPQTDSESDTGRPKVEHTPKPLPAPIPLRANRAAIVAQEQASAQDSRTGMTASSLADAMVAGSIAAQHTGSRGASPASKKVPPPIPRRRSKSVGAFVSTRQLMHLPALRRETVSQTPKLKPLPMRPMRQTLRNTSPEHDEPAEEKRGRRHWRRHPNMHHEGDRRRWRDKVTERERKRYEGVWAANRGLLLDYDLDNSGLGPRKDGTPASDLVLNVVVRDIWERSRLPKDVLEEIWDLVAQPGAKSLNREEFVVGLWLIDQRLKGRKLPVKVSPSVWSSVRHPQGVKISSYSLHK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.65
3 0.67
4 0.59
5 0.57
6 0.53
7 0.57
8 0.58
9 0.54
10 0.45
11 0.4
12 0.38
13 0.34
14 0.31
15 0.26
16 0.21
17 0.22
18 0.26
19 0.25
20 0.27
21 0.25
22 0.23
23 0.21
24 0.21
25 0.18
26 0.16
27 0.16
28 0.12
29 0.1
30 0.09
31 0.1
32 0.1
33 0.16
34 0.17
35 0.18
36 0.2
37 0.24
38 0.3
39 0.32
40 0.33
41 0.28
42 0.33
43 0.4
44 0.41
45 0.37
46 0.31
47 0.28
48 0.27
49 0.26
50 0.18
51 0.11
52 0.07
53 0.06
54 0.06
55 0.06
56 0.06
57 0.05
58 0.06
59 0.07
60 0.13
61 0.2
62 0.28
63 0.37
64 0.44
65 0.54
66 0.63
67 0.68
68 0.72
69 0.73
70 0.67
71 0.62
72 0.58
73 0.5
74 0.43
75 0.37
76 0.33
77 0.34
78 0.33
79 0.3
80 0.3
81 0.3
82 0.28
83 0.3
84 0.32
85 0.33
86 0.33
87 0.38
88 0.35
89 0.32
90 0.32
91 0.29
92 0.27
93 0.19
94 0.16
95 0.13
96 0.14
97 0.14
98 0.15
99 0.17
100 0.14
101 0.15
102 0.17
103 0.22
104 0.25
105 0.31
106 0.38
107 0.47
108 0.57
109 0.63
110 0.71
111 0.68
112 0.66
113 0.68
114 0.63
115 0.53
116 0.46
117 0.39
118 0.29
119 0.26
120 0.22
121 0.16
122 0.11
123 0.1
124 0.07
125 0.06
126 0.08
127 0.1
128 0.15
129 0.23
130 0.31
131 0.39
132 0.46
133 0.55
134 0.63
135 0.68
136 0.66
137 0.61
138 0.56
139 0.5
140 0.46
141 0.39
142 0.34
143 0.32
144 0.31
145 0.28
146 0.27
147 0.32
148 0.35
149 0.39
150 0.43
151 0.43
152 0.44
153 0.46
154 0.46
155 0.41
156 0.37
157 0.32
158 0.26
159 0.25
160 0.24
161 0.23
162 0.21
163 0.2
164 0.19
165 0.18
166 0.17
167 0.13
168 0.13
169 0.11
170 0.11
171 0.11
172 0.1
173 0.09
174 0.07
175 0.06
176 0.05
177 0.05
178 0.04
179 0.03
180 0.03
181 0.03
182 0.03
183 0.04
184 0.04
185 0.04
186 0.05
187 0.06
188 0.06
189 0.06
190 0.07
191 0.08
192 0.09
193 0.1
194 0.12
195 0.15
196 0.15
197 0.17
198 0.17
199 0.16
200 0.16
201 0.18
202 0.19
203 0.2
204 0.2
205 0.19
206 0.2
207 0.19
208 0.18
209 0.16
210 0.13
211 0.1
212 0.09
213 0.09
214 0.09
215 0.1
216 0.1
217 0.11
218 0.1
219 0.08
220 0.09
221 0.09
222 0.08
223 0.07
224 0.06
225 0.05
226 0.05
227 0.05
228 0.04
229 0.04
230 0.04
231 0.04
232 0.04
233 0.04
234 0.04
235 0.04
236 0.06
237 0.07
238 0.12
239 0.18
240 0.22
241 0.22
242 0.23
243 0.23
244 0.23
245 0.24
246 0.22
247 0.2
248 0.2
249 0.21
250 0.21
251 0.21
252 0.21
253 0.2
254 0.16
255 0.14
256 0.11
257 0.11
258 0.12
259 0.12
260 0.14
261 0.13
262 0.16
263 0.17
264 0.18
265 0.17
266 0.16
267 0.16
268 0.14
269 0.15
270 0.15
271 0.16
272 0.18
273 0.2
274 0.21
275 0.22
276 0.23
277 0.25
278 0.3
279 0.32
280 0.36
281 0.36
282 0.37
283 0.37
284 0.37
285 0.37
286 0.31
287 0.27
288 0.2
289 0.21
290 0.19
291 0.18
292 0.17
293 0.17
294 0.23
295 0.31
296 0.34
297 0.39
298 0.45
299 0.48
300 0.5
301 0.5
302 0.42
303 0.38
304 0.37
305 0.34
306 0.35
307 0.34
308 0.35
309 0.35
310 0.35
311 0.3
312 0.26
313 0.23
314 0.15
315 0.15
316 0.12
317 0.11
318 0.1
319 0.1
320 0.09
321 0.1
322 0.1
323 0.08
324 0.1
325 0.1
326 0.1
327 0.11
328 0.1
329 0.08
330 0.09
331 0.1
332 0.06
333 0.07
334 0.07
335 0.06
336 0.05
337 0.05
338 0.05
339 0.04
340 0.03
341 0.02
342 0.02
343 0.03
344 0.03
345 0.03
346 0.03
347 0.03
348 0.04
349 0.05
350 0.06
351 0.06
352 0.06
353 0.07
354 0.12
355 0.14
356 0.18
357 0.22
358 0.25
359 0.26
360 0.32
361 0.4
362 0.45
363 0.53
364 0.59
365 0.65
366 0.71
367 0.78
368 0.78
369 0.75
370 0.73
371 0.71
372 0.68
373 0.62
374 0.55
375 0.49
376 0.42
377 0.42
378 0.36
379 0.27
380 0.19
381 0.17
382 0.14
383 0.16
384 0.2
385 0.18
386 0.22
387 0.25
388 0.25
389 0.25
390 0.26
391 0.29
392 0.32
393 0.35
394 0.37
395 0.41
396 0.43
397 0.47
398 0.48
399 0.48
400 0.46
401 0.49
402 0.54
403 0.56
404 0.6
405 0.6
406 0.67
407 0.65
408 0.67
409 0.63
410 0.6
411 0.61
412 0.6
413 0.58
414 0.51
415 0.54
416 0.48
417 0.47
418 0.4
419 0.32
420 0.28
421 0.31
422 0.36
423 0.32
424 0.32
425 0.36
426 0.45
427 0.53
428 0.61
429 0.67
430 0.69
431 0.78
432 0.87
433 0.9
434 0.91
435 0.91
436 0.91
437 0.88
438 0.85
439 0.82
440 0.78
441 0.78
442 0.77
443 0.72
444 0.67
445 0.64
446 0.6
447 0.63
448 0.65
449 0.66
450 0.67
451 0.73
452 0.75
453 0.82
454 0.81
455 0.76
456 0.7
457 0.61
458 0.57
459 0.55
460 0.55
461 0.51
462 0.51
463 0.46
464 0.44
465 0.4
466 0.34
467 0.25
468 0.18
469 0.12
470 0.1
471 0.1
472 0.1
473 0.11
474 0.1
475 0.1
476 0.1
477 0.13
478 0.17
479 0.17
480 0.17
481 0.18
482 0.2
483 0.23
484 0.24
485 0.23
486 0.21
487 0.22
488 0.22
489 0.24
490 0.22
491 0.2
492 0.23
493 0.19
494 0.15
495 0.14
496 0.12
497 0.1
498 0.12
499 0.13
500 0.12
501 0.17
502 0.2
503 0.26
504 0.33
505 0.35
506 0.37
507 0.38
508 0.41
509 0.41
510 0.4
511 0.38
512 0.32
513 0.3
514 0.27
515 0.22
516 0.18
517 0.13
518 0.14
519 0.1
520 0.08
521 0.11
522 0.14
523 0.15
524 0.18
525 0.23
526 0.3
527 0.31
528 0.32
529 0.3
530 0.28
531 0.27
532 0.26
533 0.21
534 0.12
535 0.11
536 0.12
537 0.12
538 0.13
539 0.14
540 0.17
541 0.26
542 0.29
543 0.33
544 0.42
545 0.49
546 0.55
547 0.61
548 0.64
549 0.64
550 0.65
551 0.64
552 0.59
553 0.55
554 0.52
555 0.46
556 0.41
557 0.38
558 0.44
559 0.46
560 0.46
561 0.44
562 0.46
563 0.53
564 0.53
565 0.51
566 0.44
567 0.41