Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2KBW5

Protein Details
Accession A0A0D2KBW5   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
68-93TTTRDPKSTKKPSKTTSKPKSTKASTHydrophilic
NLS Segment(s)
PositionSequence
77-90KKPSKTTSKPKSTK
100-100K
Subcellular Location(s) cyto_nucl 11.5, nucl 10.5, cyto 9.5, mito 6
Family & Domain DBs
Amino Acid Sequences MEAVRFIFPPTPVWKSERLIEDNTGICPAGYNCGTGVAANRCCPPGITMQQCAQVEVIGKASTVAADTTTRDPKSTKKPSKTTSKPKSTKASTTTASSKKKKASQTPFDPLAVLII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.35
3 0.4
4 0.42
5 0.4
6 0.39
7 0.38
8 0.38
9 0.34
10 0.32
11 0.26
12 0.2
13 0.15
14 0.13
15 0.11
16 0.12
17 0.11
18 0.11
19 0.1
20 0.11
21 0.12
22 0.11
23 0.14
24 0.16
25 0.17
26 0.18
27 0.19
28 0.19
29 0.19
30 0.19
31 0.17
32 0.17
33 0.23
34 0.24
35 0.26
36 0.27
37 0.32
38 0.32
39 0.31
40 0.24
41 0.18
42 0.16
43 0.13
44 0.13
45 0.07
46 0.07
47 0.06
48 0.06
49 0.05
50 0.05
51 0.04
52 0.04
53 0.05
54 0.07
55 0.11
56 0.16
57 0.16
58 0.17
59 0.19
60 0.25
61 0.35
62 0.44
63 0.5
64 0.54
65 0.63
66 0.69
67 0.79
68 0.83
69 0.83
70 0.83
71 0.84
72 0.81
73 0.8
74 0.83
75 0.77
76 0.74
77 0.68
78 0.63
79 0.55
80 0.54
81 0.55
82 0.54
83 0.58
84 0.57
85 0.59
86 0.62
87 0.66
88 0.7
89 0.73
90 0.74
91 0.75
92 0.78
93 0.8
94 0.75
95 0.68
96 0.59