Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2JVM7

Protein Details
Accession A0A0D2JVM7   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
10-33PPPQSASPQRRPPHPQQHPHQQDAHydrophilic
164-195EVFRIQKEAERERKKRDRLKNKKTAWRDPEGSBasic
NLS Segment(s)
PositionSequence
173-187ERERKKRDRLKNKKT
Subcellular Location(s) nucl 15.5, cyto_nucl 12, cyto 7.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR034104  Lsm1  
IPR010920  LSM_dom_sf  
IPR044642  PTHR15588  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:0000932  C:P-body  
GO:1990904  C:ribonucleoprotein complex  
GO:0000339  F:RNA cap binding  
GO:0006397  P:mRNA processing  
GO:0000956  P:nuclear-transcribed mRNA catabolic process  
GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF01423  LSM  
CDD cd01728  LSm1  
Amino Acid Sequences MENLSLNDAPPPQSASPQRRPPHPQQHPHQQDAVFPGPPPPQGAPQLPPQMFTTAAQLLDLTDKKLLLVLRDGRKIFGVLRSWDQFANLVLTETKERYFVSVPSSSVSTDPANPHSQPSTRNLYCDIPRGTFLVRGENVLLLGEVDLDRDDDPPAGYEEGDVEEVFRIQKEAERERKKRDRLKNKKTAWRDPEGSGEVLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.43
3 0.51
4 0.59
5 0.63
6 0.67
7 0.74
8 0.77
9 0.79
10 0.8
11 0.8
12 0.79
13 0.85
14 0.84
15 0.8
16 0.74
17 0.63
18 0.56
19 0.52
20 0.46
21 0.35
22 0.28
23 0.28
24 0.25
25 0.25
26 0.26
27 0.21
28 0.22
29 0.26
30 0.29
31 0.27
32 0.32
33 0.4
34 0.37
35 0.37
36 0.34
37 0.31
38 0.29
39 0.27
40 0.23
41 0.16
42 0.16
43 0.14
44 0.12
45 0.11
46 0.14
47 0.14
48 0.11
49 0.11
50 0.1
51 0.1
52 0.13
53 0.13
54 0.1
55 0.15
56 0.21
57 0.26
58 0.31
59 0.31
60 0.3
61 0.29
62 0.29
63 0.25
64 0.22
65 0.2
66 0.17
67 0.21
68 0.22
69 0.23
70 0.22
71 0.21
72 0.17
73 0.14
74 0.13
75 0.09
76 0.08
77 0.07
78 0.08
79 0.09
80 0.09
81 0.09
82 0.09
83 0.09
84 0.1
85 0.11
86 0.11
87 0.14
88 0.14
89 0.14
90 0.14
91 0.15
92 0.13
93 0.12
94 0.14
95 0.1
96 0.11
97 0.12
98 0.15
99 0.17
100 0.17
101 0.19
102 0.19
103 0.2
104 0.2
105 0.23
106 0.29
107 0.26
108 0.27
109 0.28
110 0.3
111 0.3
112 0.35
113 0.32
114 0.24
115 0.25
116 0.25
117 0.23
118 0.22
119 0.21
120 0.2
121 0.18
122 0.18
123 0.18
124 0.16
125 0.16
126 0.12
127 0.11
128 0.05
129 0.05
130 0.05
131 0.04
132 0.04
133 0.04
134 0.05
135 0.06
136 0.07
137 0.07
138 0.07
139 0.08
140 0.09
141 0.11
142 0.1
143 0.1
144 0.09
145 0.09
146 0.1
147 0.11
148 0.09
149 0.08
150 0.08
151 0.08
152 0.09
153 0.08
154 0.08
155 0.07
156 0.11
157 0.18
158 0.28
159 0.38
160 0.48
161 0.55
162 0.65
163 0.75
164 0.82
165 0.84
166 0.86
167 0.87
168 0.88
169 0.92
170 0.92
171 0.92
172 0.92
173 0.92
174 0.91
175 0.87
176 0.85
177 0.78
178 0.7
179 0.67
180 0.6