Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2K8R6

Protein Details
Accession A0A0D2K8R6    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MPRYSTHGDKPRRKLSKHKYSKINSPPPSHydrophilic
NLS Segment(s)
PositionSequence
11-17PRRKLSK
Subcellular Location(s) nucl 20, mito_nucl 14.166, cyto_nucl 11.666, mito 6
Family & Domain DBs
Amino Acid Sequences MPRYSTHGDKPRRKLSKHKYSKINSPPPSITSEAPLLPKPLWTWKDSIKYYVARAKGEVKYAIDMYRINKVLGEEFDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.81
3 0.82
4 0.84
5 0.83
6 0.82
7 0.79
8 0.84
9 0.84
10 0.83
11 0.76
12 0.7
13 0.63
14 0.55
15 0.54
16 0.46
17 0.35
18 0.27
19 0.25
20 0.2
21 0.2
22 0.19
23 0.16
24 0.14
25 0.14
26 0.13
27 0.18
28 0.19
29 0.19
30 0.21
31 0.25
32 0.32
33 0.33
34 0.34
35 0.31
36 0.31
37 0.34
38 0.37
39 0.34
40 0.27
41 0.29
42 0.33
43 0.3
44 0.32
45 0.3
46 0.26
47 0.26
48 0.27
49 0.25
50 0.21
51 0.21
52 0.2
53 0.26
54 0.26
55 0.23
56 0.23
57 0.24
58 0.25