Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2KK31

Protein Details
Accession A0A0D2KK31   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
46-68LSQSYRPCRRSARCRTDRRSALGHydrophilic
NLS Segment(s)
PositionSequence
73-76RLRR
Subcellular Location(s) nucl 14, mito_nucl 12.833, mito 10.5, cyto_nucl 8.833
Family & Domain DBs
Amino Acid Sequences MYQDGVARGGQVHRGRVRPLVEYGLDNAIEPVEGLVVDNSHGRSGLSQSYRPCRRSARCRTDRRSALGPARVRLRRHKHLGRILDTLHGIASGEANNIFLVDNGGFANLVPKFPYVNVTSSQTDPNVQGRAYKAAWMVDAYTMSIMNLTRPSPDAFAYLKSKVSNKYPVTRYQTTGVKLNGICVTNTWTSMLDPEAYLSNYTLAGVPSAKYSNPFGLTSSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.45
4 0.46
5 0.41
6 0.41
7 0.37
8 0.33
9 0.3
10 0.3
11 0.27
12 0.24
13 0.21
14 0.18
15 0.13
16 0.11
17 0.09
18 0.07
19 0.04
20 0.04
21 0.05
22 0.05
23 0.05
24 0.06
25 0.08
26 0.09
27 0.09
28 0.09
29 0.09
30 0.09
31 0.12
32 0.18
33 0.2
34 0.23
35 0.29
36 0.39
37 0.47
38 0.48
39 0.5
40 0.52
41 0.58
42 0.65
43 0.7
44 0.72
45 0.74
46 0.83
47 0.85
48 0.86
49 0.81
50 0.76
51 0.7
52 0.65
53 0.61
54 0.58
55 0.53
56 0.47
57 0.5
58 0.5
59 0.49
60 0.53
61 0.55
62 0.56
63 0.64
64 0.67
65 0.67
66 0.7
67 0.73
68 0.67
69 0.61
70 0.52
71 0.44
72 0.38
73 0.29
74 0.21
75 0.14
76 0.09
77 0.06
78 0.06
79 0.05
80 0.05
81 0.05
82 0.05
83 0.05
84 0.05
85 0.05
86 0.04
87 0.05
88 0.04
89 0.05
90 0.04
91 0.05
92 0.04
93 0.04
94 0.07
95 0.06
96 0.07
97 0.07
98 0.07
99 0.07
100 0.08
101 0.11
102 0.1
103 0.11
104 0.13
105 0.16
106 0.17
107 0.18
108 0.19
109 0.17
110 0.16
111 0.16
112 0.18
113 0.15
114 0.14
115 0.14
116 0.14
117 0.18
118 0.17
119 0.17
120 0.15
121 0.14
122 0.14
123 0.12
124 0.12
125 0.09
126 0.09
127 0.07
128 0.06
129 0.06
130 0.05
131 0.06
132 0.06
133 0.06
134 0.08
135 0.08
136 0.09
137 0.1
138 0.12
139 0.12
140 0.13
141 0.15
142 0.14
143 0.18
144 0.21
145 0.21
146 0.22
147 0.23
148 0.26
149 0.26
150 0.31
151 0.36
152 0.37
153 0.45
154 0.46
155 0.53
156 0.58
157 0.57
158 0.55
159 0.51
160 0.52
161 0.46
162 0.48
163 0.4
164 0.37
165 0.33
166 0.34
167 0.31
168 0.27
169 0.24
170 0.19
171 0.23
172 0.19
173 0.19
174 0.17
175 0.14
176 0.14
177 0.15
178 0.16
179 0.12
180 0.11
181 0.11
182 0.12
183 0.13
184 0.13
185 0.12
186 0.12
187 0.11
188 0.12
189 0.11
190 0.09
191 0.1
192 0.1
193 0.1
194 0.13
195 0.15
196 0.15
197 0.17
198 0.2
199 0.24
200 0.26
201 0.26