Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2KMS5

Protein Details
Accession A0A0D2KMS5   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
147-172VPDEVVHPRRPRRRPPPPPQSNVKLSHydrophilic
NLS Segment(s)
PositionSequence
155-162RRPRRRPP
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR018306  Phage_T5_Orf172_DNA-bd  
Pfam View protein in Pfam  
PF10544  T5orf172  
Amino Acid Sequences MSFSGKTPESLLPRSDSRNPATTCRGITTTGRPCRRPLAASPKNSSTPSPSRGNGVLAVLDEQHAAAFYCWQHKDQAEQLAAQGGRTSLYPLKERSSIDTLIEQVGILDLEENVPKRHHRRQIAESVKRRDTLPSGWNQMESPLMTVPDEVVHPRRPRRRPPPPPQSNVKLSWACCIQADHDDDLPPVRVRRDDRDRLPRPHTDARRPSSGRPEMRQSHTTTTRPKPSPAPSQTQTLLSLIPPNLSPQITSQLLAELSRPISAADEAGYIYIFWLTPESEMSKPDDETASSLLDDDEDNLGDSGGGMYNRSLQRTNQALARYASVRRPSNQVQAKRTITLKIGRAANVHRRMTQWTKQCGQNITLIRYYPHNNGASGNTHTPRRPPPAAAAAGSTSAAPPSPQSHSTKVSHVHKVERLIHLELSQKKAIKSECEQCGREHKEWFEIEATREGLRGVDEVVRRWVAWAERQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.49
3 0.5
4 0.49
5 0.54
6 0.54
7 0.55
8 0.58
9 0.56
10 0.5
11 0.47
12 0.44
13 0.38
14 0.4
15 0.43
16 0.46
17 0.52
18 0.57
19 0.55
20 0.58
21 0.62
22 0.62
23 0.57
24 0.57
25 0.58
26 0.59
27 0.65
28 0.67
29 0.66
30 0.65
31 0.62
32 0.55
33 0.52
34 0.51
35 0.49
36 0.48
37 0.43
38 0.44
39 0.43
40 0.43
41 0.36
42 0.29
43 0.24
44 0.18
45 0.18
46 0.13
47 0.12
48 0.1
49 0.09
50 0.07
51 0.07
52 0.07
53 0.06
54 0.09
55 0.11
56 0.18
57 0.2
58 0.22
59 0.26
60 0.26
61 0.31
62 0.33
63 0.39
64 0.33
65 0.32
66 0.31
67 0.32
68 0.31
69 0.26
70 0.21
71 0.14
72 0.13
73 0.12
74 0.16
75 0.13
76 0.17
77 0.22
78 0.24
79 0.27
80 0.31
81 0.33
82 0.35
83 0.36
84 0.34
85 0.31
86 0.3
87 0.27
88 0.24
89 0.22
90 0.16
91 0.11
92 0.1
93 0.08
94 0.06
95 0.05
96 0.04
97 0.05
98 0.08
99 0.09
100 0.11
101 0.13
102 0.21
103 0.28
104 0.37
105 0.45
106 0.52
107 0.59
108 0.65
109 0.73
110 0.77
111 0.79
112 0.79
113 0.78
114 0.72
115 0.66
116 0.59
117 0.51
118 0.45
119 0.4
120 0.37
121 0.35
122 0.38
123 0.37
124 0.37
125 0.33
126 0.3
127 0.26
128 0.2
129 0.15
130 0.1
131 0.1
132 0.09
133 0.09
134 0.09
135 0.08
136 0.09
137 0.1
138 0.14
139 0.2
140 0.27
141 0.36
142 0.45
143 0.53
144 0.63
145 0.71
146 0.78
147 0.82
148 0.87
149 0.89
150 0.89
151 0.87
152 0.85
153 0.8
154 0.74
155 0.66
156 0.61
157 0.53
158 0.44
159 0.41
160 0.34
161 0.28
162 0.23
163 0.21
164 0.16
165 0.17
166 0.19
167 0.18
168 0.18
169 0.18
170 0.17
171 0.17
172 0.18
173 0.14
174 0.13
175 0.13
176 0.16
177 0.19
178 0.28
179 0.36
180 0.42
181 0.49
182 0.59
183 0.65
184 0.67
185 0.69
186 0.64
187 0.62
188 0.64
189 0.62
190 0.61
191 0.62
192 0.6
193 0.63
194 0.61
195 0.57
196 0.57
197 0.59
198 0.53
199 0.48
200 0.52
201 0.49
202 0.51
203 0.52
204 0.45
205 0.44
206 0.45
207 0.46
208 0.46
209 0.46
210 0.5
211 0.48
212 0.47
213 0.47
214 0.48
215 0.53
216 0.5
217 0.51
218 0.44
219 0.46
220 0.44
221 0.39
222 0.34
223 0.25
224 0.2
225 0.13
226 0.14
227 0.1
228 0.1
229 0.09
230 0.09
231 0.1
232 0.1
233 0.1
234 0.09
235 0.13
236 0.13
237 0.13
238 0.12
239 0.12
240 0.12
241 0.11
242 0.11
243 0.08
244 0.07
245 0.07
246 0.07
247 0.06
248 0.07
249 0.07
250 0.07
251 0.06
252 0.06
253 0.05
254 0.05
255 0.05
256 0.04
257 0.04
258 0.04
259 0.04
260 0.03
261 0.04
262 0.04
263 0.05
264 0.06
265 0.09
266 0.1
267 0.11
268 0.14
269 0.15
270 0.15
271 0.15
272 0.15
273 0.12
274 0.13
275 0.13
276 0.11
277 0.09
278 0.09
279 0.08
280 0.08
281 0.07
282 0.07
283 0.06
284 0.06
285 0.06
286 0.06
287 0.06
288 0.05
289 0.05
290 0.04
291 0.05
292 0.05
293 0.05
294 0.05
295 0.12
296 0.13
297 0.15
298 0.17
299 0.16
300 0.23
301 0.27
302 0.28
303 0.26
304 0.26
305 0.27
306 0.27
307 0.28
308 0.24
309 0.23
310 0.27
311 0.3
312 0.32
313 0.31
314 0.37
315 0.38
316 0.46
317 0.51
318 0.53
319 0.52
320 0.57
321 0.57
322 0.53
323 0.51
324 0.44
325 0.4
326 0.38
327 0.37
328 0.35
329 0.35
330 0.33
331 0.35
332 0.38
333 0.44
334 0.46
335 0.45
336 0.41
337 0.4
338 0.46
339 0.5
340 0.51
341 0.5
342 0.49
343 0.52
344 0.55
345 0.59
346 0.55
347 0.49
348 0.49
349 0.44
350 0.41
351 0.38
352 0.34
353 0.3
354 0.31
355 0.33
356 0.3
357 0.32
358 0.29
359 0.28
360 0.29
361 0.31
362 0.3
363 0.3
364 0.32
365 0.29
366 0.31
367 0.33
368 0.37
369 0.42
370 0.46
371 0.46
372 0.42
373 0.45
374 0.49
375 0.5
376 0.44
377 0.38
378 0.31
379 0.28
380 0.26
381 0.2
382 0.12
383 0.1
384 0.09
385 0.07
386 0.09
387 0.12
388 0.17
389 0.22
390 0.27
391 0.32
392 0.38
393 0.4
394 0.44
395 0.49
396 0.51
397 0.55
398 0.54
399 0.56
400 0.55
401 0.6
402 0.6
403 0.57
404 0.54
405 0.48
406 0.45
407 0.4
408 0.44
409 0.41
410 0.41
411 0.4
412 0.39
413 0.38
414 0.42
415 0.43
416 0.43
417 0.45
418 0.48
419 0.52
420 0.57
421 0.57
422 0.56
423 0.63
424 0.63
425 0.6
426 0.57
427 0.51
428 0.51
429 0.5
430 0.49
431 0.43
432 0.38
433 0.37
434 0.35
435 0.34
436 0.27
437 0.26
438 0.23
439 0.19
440 0.17
441 0.14
442 0.12
443 0.16
444 0.18
445 0.2
446 0.25
447 0.26
448 0.25
449 0.25
450 0.28