Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2I672

Protein Details
Accession A0A0D2I672    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
58-80GDNSRKKSFRERIKDKWNKLKGSBasic
NLS Segment(s)
PositionSequence
61-91SRKKSFRERIKDKWNKLKGSIGSNRTNKMGK
Subcellular Location(s) nucl 21.5, mito_nucl 13.666, cyto_nucl 12.333
Family & Domain DBs
Amino Acid Sequences MSPGQQNRGSRNSGNRPSSSVGWNQGVKQETDTIRPGGYGNDAYSGFDKTGERPNRQGDNSRKKSFRERIKDKWNKLKGSIGSNRTNKMGKESRQQRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.57
3 0.56
4 0.55
5 0.52
6 0.46
7 0.4
8 0.35
9 0.34
10 0.34
11 0.31
12 0.31
13 0.3
14 0.27
15 0.24
16 0.25
17 0.22
18 0.24
19 0.25
20 0.21
21 0.2
22 0.19
23 0.18
24 0.13
25 0.14
26 0.11
27 0.09
28 0.1
29 0.1
30 0.11
31 0.11
32 0.11
33 0.09
34 0.09
35 0.1
36 0.1
37 0.19
38 0.23
39 0.25
40 0.28
41 0.34
42 0.38
43 0.39
44 0.46
45 0.48
46 0.54
47 0.6
48 0.63
49 0.61
50 0.59
51 0.68
52 0.68
53 0.68
54 0.68
55 0.68
56 0.7
57 0.79
58 0.85
59 0.84
60 0.86
61 0.83
62 0.76
63 0.71
64 0.69
65 0.62
66 0.61
67 0.6
68 0.56
69 0.58
70 0.59
71 0.58
72 0.55
73 0.55
74 0.46
75 0.47
76 0.49
77 0.46
78 0.53