Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2KM64

Protein Details
Accession A0A0D2KM64    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
20-44AKGARLKKSHKSKDIKMKIRCKRYLBasic
NLS Segment(s)
PositionSequence
16-38RRKDAKGARLKKSHKSKDIKMKI
73-81KKNKKPKKN
Subcellular Location(s) nucl 22.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPSEVTDIKQFLEIARRKDAKGARLKKSHKSKDIKMKIRCKRYLYTLILKDSDKADKIKQSLPPTMPFSEISKKNKKPKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.37
3 0.39
4 0.38
5 0.45
6 0.48
7 0.47
8 0.53
9 0.57
10 0.57
11 0.63
12 0.68
13 0.71
14 0.77
15 0.77
16 0.76
17 0.75
18 0.75
19 0.77
20 0.82
21 0.81
22 0.8
23 0.81
24 0.79
25 0.81
26 0.78
27 0.71
28 0.63
29 0.6
30 0.59
31 0.54
32 0.54
33 0.48
34 0.45
35 0.42
36 0.4
37 0.35
38 0.29
39 0.27
40 0.21
41 0.2
42 0.22
43 0.25
44 0.28
45 0.31
46 0.36
47 0.38
48 0.43
49 0.44
50 0.45
51 0.45
52 0.43
53 0.4
54 0.35
55 0.35
56 0.38
57 0.42
58 0.46
59 0.52
60 0.6
61 0.68