Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2KN15

Protein Details
Accession A0A0D2KN15    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
54-76DGDHTEEKPRRKRLSRLLSGGKRBasic
NLS Segment(s)
PositionSequence
61-76KPRRKRLSRLLSGGKR
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MPSKFTEILDPQYQTTSPQDDVRLEDIIGAVSMSIRDRTSSEASSTSPSSSSADGDHTEEKPRRKRLSRLLSGGKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.24
4 0.21
5 0.22
6 0.23
7 0.22
8 0.25
9 0.25
10 0.22
11 0.18
12 0.16
13 0.13
14 0.11
15 0.1
16 0.06
17 0.04
18 0.03
19 0.04
20 0.04
21 0.05
22 0.05
23 0.06
24 0.07
25 0.11
26 0.13
27 0.14
28 0.14
29 0.14
30 0.15
31 0.18
32 0.18
33 0.15
34 0.12
35 0.13
36 0.13
37 0.12
38 0.12
39 0.1
40 0.12
41 0.13
42 0.15
43 0.17
44 0.17
45 0.25
46 0.3
47 0.38
48 0.45
49 0.53
50 0.6
51 0.65
52 0.73
53 0.76
54 0.82
55 0.82
56 0.83