Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2K904

Protein Details
Accession A0A0D2K904    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
68-93LWAVCWVKKPKRPKHLKVRKYKELAVHydrophilic
NLS Segment(s)
PositionSequence
75-87KKPKRPKHLKVRK
Subcellular Location(s) cyto 13.5, cyto_nucl 12.166, cyto_mito 8.999, nucl 8.5, mito_nucl 6.499
Family & Domain DBs
Amino Acid Sequences MATKVPNNSPNLLPTRPICPEVQFVDKAPADASEILSTINSKQTEDNKLEGIILYICKNRPNCKGMGLWAVCWVKKPKRPKHLKVRKYKELAVAKVCADCEFAEWELVDKAESEGKGKDEAEDWVGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.35
3 0.35
4 0.36
5 0.31
6 0.28
7 0.32
8 0.32
9 0.35
10 0.3
11 0.28
12 0.32
13 0.3
14 0.28
15 0.24
16 0.2
17 0.17
18 0.16
19 0.17
20 0.1
21 0.1
22 0.1
23 0.1
24 0.1
25 0.09
26 0.13
27 0.12
28 0.12
29 0.16
30 0.21
31 0.26
32 0.28
33 0.29
34 0.24
35 0.24
36 0.23
37 0.19
38 0.15
39 0.1
40 0.09
41 0.08
42 0.1
43 0.1
44 0.15
45 0.18
46 0.22
47 0.26
48 0.28
49 0.27
50 0.28
51 0.28
52 0.26
53 0.3
54 0.26
55 0.21
56 0.24
57 0.24
58 0.22
59 0.24
60 0.29
61 0.28
62 0.34
63 0.45
64 0.48
65 0.58
66 0.69
67 0.75
68 0.8
69 0.85
70 0.89
71 0.89
72 0.89
73 0.88
74 0.83
75 0.77
76 0.75
77 0.71
78 0.66
79 0.58
80 0.51
81 0.42
82 0.38
83 0.34
84 0.25
85 0.19
86 0.15
87 0.13
88 0.13
89 0.13
90 0.12
91 0.12
92 0.13
93 0.12
94 0.12
95 0.11
96 0.09
97 0.1
98 0.13
99 0.13
100 0.14
101 0.15
102 0.17
103 0.2
104 0.2
105 0.2
106 0.17
107 0.19