Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2H7Y4

Protein Details
Accession A0A0D2H7Y4    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
11-45AGKVKSQTPKVEKQEKKKTPKGRAKKRITYTRRFVHydrophilic
NLS Segment(s)
PositionSequence
12-37GKVKSQTPKVEKQEKKKTPKGRAKKR
Subcellular Location(s) mito 14.5, mito_nucl 10.5, cyto 6.5, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVEKQEKKKTPKGRAKKRITYTRRFVNVTMTGGKRKVWMSWNTTMRIACASDDGMLMVISTDEPQPDIISTNLLAMRW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.43
3 0.48
4 0.52
5 0.56
6 0.65
7 0.68
8 0.74
9 0.75
10 0.77
11 0.81
12 0.81
13 0.84
14 0.84
15 0.84
16 0.84
17 0.87
18 0.88
19 0.88
20 0.89
21 0.89
22 0.89
23 0.89
24 0.89
25 0.86
26 0.83
27 0.79
28 0.76
29 0.71
30 0.63
31 0.54
32 0.49
33 0.42
34 0.36
35 0.33
36 0.26
37 0.23
38 0.22
39 0.22
40 0.19
41 0.18
42 0.19
43 0.21
44 0.24
45 0.28
46 0.36
47 0.39
48 0.39
49 0.41
50 0.38
51 0.32
52 0.28
53 0.23
54 0.15
55 0.12
56 0.11
57 0.09
58 0.09
59 0.08
60 0.07
61 0.06
62 0.06
63 0.05
64 0.04
65 0.04
66 0.05
67 0.06
68 0.06
69 0.07
70 0.08
71 0.08
72 0.09
73 0.1
74 0.1
75 0.11
76 0.11
77 0.14