Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2K762

Protein Details
Accession A0A0D2K762    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
93-113EKQSAATTLDKKRRRRHKRKPBasic
NLS Segment(s)
PositionSequence
103-113KKRRRRHKRKP
Subcellular Location(s) nucl 17.5, cyto_nucl 12.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MTDNEITFNISFEAKSSCFNEFVNMIVRDSRWPTNVSFVSYNAAVGRLVSTDWAKVDFPNMIEVIVANGYTVTVTDVNTYTITKTVLGTVTTEKQSAATTLDKKRRRRHKRKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.17
3 0.18
4 0.19
5 0.2
6 0.2
7 0.21
8 0.18
9 0.18
10 0.22
11 0.2
12 0.19
13 0.18
14 0.19
15 0.2
16 0.23
17 0.24
18 0.19
19 0.21
20 0.21
21 0.27
22 0.27
23 0.27
24 0.24
25 0.22
26 0.22
27 0.2
28 0.2
29 0.13
30 0.12
31 0.09
32 0.07
33 0.07
34 0.05
35 0.05
36 0.06
37 0.06
38 0.06
39 0.06
40 0.08
41 0.08
42 0.07
43 0.09
44 0.08
45 0.08
46 0.09
47 0.08
48 0.07
49 0.07
50 0.07
51 0.06
52 0.05
53 0.05
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.04
60 0.05
61 0.05
62 0.06
63 0.07
64 0.08
65 0.09
66 0.1
67 0.09
68 0.1
69 0.1
70 0.09
71 0.09
72 0.1
73 0.1
74 0.1
75 0.12
76 0.14
77 0.18
78 0.19
79 0.19
80 0.17
81 0.17
82 0.18
83 0.17
84 0.16
85 0.19
86 0.25
87 0.34
88 0.44
89 0.51
90 0.6
91 0.7
92 0.78
93 0.83