Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2JZP8

Protein Details
Accession A0A0D2JZP8    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
56-80REENERAKGRGKKKKSIKDVVKQGEBasic
NLS Segment(s)
PositionSequence
59-73NERAKGRGKKKKSIK
Subcellular Location(s) mito 13.5, nucl 10.5, cyto_mito 8.833, cyto_nucl 7.333
Family & Domain DBs
Amino Acid Sequences MAPIRRYLRISKYSVLECRIFLENPADESRWLLNEKEPALPRIFEAVRPFVLPKLREENERAKGRGKKKKSIKDVVKQGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.5
3 0.43
4 0.36
5 0.35
6 0.33
7 0.28
8 0.23
9 0.22
10 0.18
11 0.2
12 0.22
13 0.19
14 0.16
15 0.18
16 0.17
17 0.15
18 0.16
19 0.13
20 0.14
21 0.16
22 0.18
23 0.21
24 0.21
25 0.21
26 0.21
27 0.2
28 0.18
29 0.19
30 0.18
31 0.15
32 0.17
33 0.17
34 0.16
35 0.17
36 0.17
37 0.16
38 0.21
39 0.19
40 0.21
41 0.27
42 0.29
43 0.31
44 0.36
45 0.42
46 0.46
47 0.51
48 0.49
49 0.49
50 0.56
51 0.63
52 0.68
53 0.67
54 0.68
55 0.73
56 0.82
57 0.84
58 0.87
59 0.86
60 0.86