Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2KW05

Protein Details
Accession A0A0D2KW05    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
353-379FPRGSLRDWKTKDCKRKARWRFLEDLVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 10, extr 10, cyto_nucl 6.833, cyto_mito 6.333, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001279  Metallo-B-lactamas  
IPR036866  RibonucZ/Hydroxyglut_hydro  
Pfam View protein in Pfam  
PF00753  Lactamase_B  
CDD cd07730  metallo-hydrolase-like_MBL-fold  
Amino Acid Sequences MTSTNENQALLYAPKPAPVLNLPPGAAAKVQIIDTTSRLDVPTQIFMGPKIFGHEILKVPSFSFLVEQVSSGRKVLFDLGCRKDWQSLPPLILGLVTQPGWKIEVEKDSVAQILQDDGVDVASGAIEAIIWSHWHYDHTGDPSTFPASTSLIVGPGVKEVFLPPYPENAQSPLLDTDFAGRELKVVDFENWGIVQIGRFRAIDYFNDGSFYILDAPGHAVGHLCALARVTSTQDGDVEGDTFVLMGADAAHHGAELRPTQYLPLPKTVSPSPYVSKYPGVCPGQLFEAIHPRHKAVEPFYHILHEGCGVAHHDPAQAQDIVGVVQEFDAADNVFVVIAHDASLLHESVGIEWFPRGSLRDWKTKDCKRKARWRFLEDLVPAVEHAADIDTATASAATATATN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.22
4 0.23
5 0.25
6 0.31
7 0.3
8 0.33
9 0.31
10 0.31
11 0.32
12 0.28
13 0.24
14 0.19
15 0.15
16 0.14
17 0.14
18 0.13
19 0.14
20 0.14
21 0.15
22 0.18
23 0.16
24 0.16
25 0.16
26 0.17
27 0.19
28 0.2
29 0.22
30 0.2
31 0.2
32 0.2
33 0.2
34 0.21
35 0.18
36 0.15
37 0.17
38 0.16
39 0.17
40 0.19
41 0.22
42 0.23
43 0.26
44 0.28
45 0.24
46 0.23
47 0.23
48 0.21
49 0.17
50 0.16
51 0.13
52 0.14
53 0.14
54 0.14
55 0.14
56 0.17
57 0.18
58 0.17
59 0.16
60 0.13
61 0.14
62 0.2
63 0.2
64 0.23
65 0.31
66 0.35
67 0.37
68 0.39
69 0.4
70 0.4
71 0.39
72 0.37
73 0.36
74 0.34
75 0.33
76 0.32
77 0.31
78 0.24
79 0.22
80 0.17
81 0.11
82 0.09
83 0.08
84 0.08
85 0.08
86 0.08
87 0.09
88 0.1
89 0.11
90 0.13
91 0.16
92 0.19
93 0.19
94 0.19
95 0.19
96 0.19
97 0.16
98 0.13
99 0.1
100 0.07
101 0.07
102 0.06
103 0.05
104 0.05
105 0.05
106 0.05
107 0.04
108 0.03
109 0.03
110 0.03
111 0.02
112 0.02
113 0.02
114 0.02
115 0.02
116 0.03
117 0.03
118 0.04
119 0.06
120 0.06
121 0.07
122 0.08
123 0.1
124 0.13
125 0.16
126 0.19
127 0.18
128 0.18
129 0.19
130 0.2
131 0.18
132 0.15
133 0.12
134 0.1
135 0.11
136 0.11
137 0.1
138 0.09
139 0.09
140 0.09
141 0.07
142 0.08
143 0.07
144 0.06
145 0.06
146 0.06
147 0.09
148 0.1
149 0.13
150 0.12
151 0.17
152 0.18
153 0.2
154 0.2
155 0.2
156 0.21
157 0.17
158 0.18
159 0.15
160 0.14
161 0.13
162 0.12
163 0.12
164 0.11
165 0.11
166 0.1
167 0.09
168 0.09
169 0.09
170 0.1
171 0.09
172 0.09
173 0.09
174 0.09
175 0.09
176 0.1
177 0.09
178 0.09
179 0.08
180 0.07
181 0.07
182 0.08
183 0.08
184 0.09
185 0.09
186 0.09
187 0.1
188 0.12
189 0.11
190 0.15
191 0.15
192 0.14
193 0.15
194 0.15
195 0.13
196 0.12
197 0.12
198 0.07
199 0.06
200 0.06
201 0.05
202 0.06
203 0.06
204 0.06
205 0.05
206 0.05
207 0.05
208 0.05
209 0.05
210 0.04
211 0.04
212 0.04
213 0.05
214 0.05
215 0.05
216 0.07
217 0.08
218 0.08
219 0.09
220 0.09
221 0.09
222 0.09
223 0.09
224 0.08
225 0.06
226 0.06
227 0.05
228 0.05
229 0.04
230 0.03
231 0.03
232 0.02
233 0.02
234 0.02
235 0.03
236 0.03
237 0.03
238 0.03
239 0.03
240 0.04
241 0.06
242 0.07
243 0.08
244 0.09
245 0.09
246 0.1
247 0.14
248 0.19
249 0.19
250 0.24
251 0.26
252 0.26
253 0.31
254 0.32
255 0.31
256 0.28
257 0.3
258 0.27
259 0.28
260 0.29
261 0.28
262 0.3
263 0.29
264 0.29
265 0.33
266 0.32
267 0.29
268 0.27
269 0.26
270 0.23
271 0.24
272 0.21
273 0.15
274 0.23
275 0.23
276 0.27
277 0.27
278 0.26
279 0.28
280 0.3
281 0.32
282 0.28
283 0.34
284 0.36
285 0.37
286 0.37
287 0.35
288 0.33
289 0.29
290 0.25
291 0.18
292 0.12
293 0.09
294 0.09
295 0.1
296 0.1
297 0.11
298 0.11
299 0.11
300 0.11
301 0.13
302 0.15
303 0.13
304 0.12
305 0.12
306 0.11
307 0.1
308 0.1
309 0.08
310 0.05
311 0.05
312 0.05
313 0.04
314 0.05
315 0.05
316 0.05
317 0.05
318 0.05
319 0.05
320 0.05
321 0.05
322 0.05
323 0.05
324 0.05
325 0.05
326 0.05
327 0.05
328 0.07
329 0.09
330 0.08
331 0.07
332 0.09
333 0.09
334 0.1
335 0.11
336 0.1
337 0.09
338 0.09
339 0.1
340 0.09
341 0.1
342 0.12
343 0.14
344 0.24
345 0.29
346 0.39
347 0.44
348 0.53
349 0.62
350 0.7
351 0.77
352 0.78
353 0.83
354 0.84
355 0.9
356 0.92
357 0.92
358 0.93
359 0.89
360 0.85
361 0.79
362 0.77
363 0.67
364 0.6
365 0.49
366 0.39
367 0.31
368 0.25
369 0.2
370 0.11
371 0.1
372 0.07
373 0.06
374 0.06
375 0.07
376 0.06
377 0.06
378 0.07
379 0.06
380 0.05
381 0.05
382 0.05