Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2JLF0

Protein Details
Accession A0A0D2JLF0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
330-359AISLKWRACLRKARRKSKKEGKDPSQVERTHydrophilic
NLS Segment(s)
PositionSequence
340-351RKARRKSKKEGK
Subcellular Location(s) cysk 19, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR029130  Acid_ceramidase_N  
Pfam View protein in Pfam  
PF15508  NAAA-beta  
Amino Acid Sequences MAFKDENNTMVAPIYIIDLSLEPENRYKALAQAYKSQLQGLTSLFNSLLSDIGLSRFYHGPVSLLARLLLRGLYSPAETAELRGIAKVSGVPMHLLVSFNVILDCLMGCTSGAVKVLEAGRPTGQSRMLHFRTLDWSMDPLRSIIVQLEFVRSRSATPGQIVARSVTYVGFTGILTGVREELSLSLNFRGVHNAARRRDHARFYLHHLLVLLGYRQSISSILRGYITPEDPEDDQCKSLQEISDELVPRHTTAAYLLFCDGVSAMVIEKDYETGVVRQSNTFIGVTNNDEEEFGCSNEATPFAAQVSAKTSGVRAGMEALIEESRDRLDAISLKWRACLRKARRKSKKEGKDPSQVERTLAITTDEVIEWVSAYPTTNEQTHFATVMDPVNGQVVWTRTYPEPAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.08
3 0.08
4 0.08
5 0.08
6 0.1
7 0.14
8 0.15
9 0.15
10 0.2
11 0.22
12 0.22
13 0.23
14 0.22
15 0.23
16 0.3
17 0.34
18 0.33
19 0.4
20 0.45
21 0.48
22 0.48
23 0.45
24 0.37
25 0.32
26 0.32
27 0.24
28 0.21
29 0.17
30 0.18
31 0.15
32 0.14
33 0.14
34 0.12
35 0.11
36 0.07
37 0.08
38 0.07
39 0.08
40 0.1
41 0.1
42 0.13
43 0.14
44 0.15
45 0.16
46 0.16
47 0.16
48 0.16
49 0.21
50 0.19
51 0.18
52 0.18
53 0.17
54 0.17
55 0.16
56 0.14
57 0.09
58 0.09
59 0.1
60 0.1
61 0.1
62 0.11
63 0.1
64 0.13
65 0.12
66 0.13
67 0.13
68 0.13
69 0.13
70 0.13
71 0.13
72 0.1
73 0.1
74 0.1
75 0.09
76 0.09
77 0.1
78 0.1
79 0.1
80 0.11
81 0.11
82 0.11
83 0.1
84 0.11
85 0.11
86 0.1
87 0.1
88 0.09
89 0.08
90 0.07
91 0.07
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.05
98 0.06
99 0.07
100 0.07
101 0.07
102 0.1
103 0.11
104 0.13
105 0.13
106 0.13
107 0.13
108 0.15
109 0.16
110 0.16
111 0.19
112 0.19
113 0.23
114 0.31
115 0.31
116 0.32
117 0.31
118 0.3
119 0.31
120 0.31
121 0.28
122 0.19
123 0.19
124 0.18
125 0.19
126 0.17
127 0.13
128 0.11
129 0.1
130 0.1
131 0.09
132 0.08
133 0.1
134 0.1
135 0.14
136 0.14
137 0.15
138 0.16
139 0.14
140 0.14
141 0.16
142 0.18
143 0.15
144 0.15
145 0.2
146 0.19
147 0.2
148 0.2
149 0.17
150 0.15
151 0.14
152 0.13
153 0.08
154 0.08
155 0.07
156 0.06
157 0.06
158 0.05
159 0.06
160 0.06
161 0.06
162 0.05
163 0.05
164 0.05
165 0.05
166 0.05
167 0.05
168 0.05
169 0.07
170 0.07
171 0.08
172 0.08
173 0.1
174 0.1
175 0.1
176 0.12
177 0.11
178 0.16
179 0.21
180 0.28
181 0.3
182 0.33
183 0.36
184 0.4
185 0.43
186 0.41
187 0.39
188 0.37
189 0.35
190 0.4
191 0.46
192 0.4
193 0.36
194 0.33
195 0.28
196 0.23
197 0.22
198 0.14
199 0.05
200 0.05
201 0.05
202 0.05
203 0.05
204 0.06
205 0.06
206 0.08
207 0.08
208 0.09
209 0.09
210 0.09
211 0.11
212 0.13
213 0.13
214 0.11
215 0.11
216 0.12
217 0.13
218 0.15
219 0.15
220 0.14
221 0.14
222 0.14
223 0.14
224 0.13
225 0.14
226 0.12
227 0.11
228 0.11
229 0.11
230 0.15
231 0.15
232 0.15
233 0.15
234 0.15
235 0.14
236 0.14
237 0.13
238 0.09
239 0.09
240 0.13
241 0.11
242 0.12
243 0.12
244 0.11
245 0.11
246 0.11
247 0.09
248 0.05
249 0.05
250 0.04
251 0.04
252 0.04
253 0.04
254 0.04
255 0.05
256 0.05
257 0.05
258 0.05
259 0.06
260 0.07
261 0.1
262 0.13
263 0.13
264 0.13
265 0.15
266 0.15
267 0.15
268 0.14
269 0.12
270 0.11
271 0.12
272 0.14
273 0.14
274 0.14
275 0.13
276 0.13
277 0.12
278 0.14
279 0.14
280 0.11
281 0.11
282 0.1
283 0.11
284 0.11
285 0.11
286 0.09
287 0.08
288 0.08
289 0.08
290 0.1
291 0.09
292 0.09
293 0.13
294 0.14
295 0.15
296 0.14
297 0.14
298 0.15
299 0.16
300 0.15
301 0.12
302 0.11
303 0.11
304 0.11
305 0.1
306 0.09
307 0.09
308 0.09
309 0.08
310 0.07
311 0.07
312 0.08
313 0.08
314 0.07
315 0.1
316 0.13
317 0.15
318 0.24
319 0.27
320 0.27
321 0.31
322 0.36
323 0.37
324 0.41
325 0.49
326 0.51
327 0.59
328 0.69
329 0.77
330 0.83
331 0.88
332 0.92
333 0.92
334 0.92
335 0.92
336 0.92
337 0.89
338 0.89
339 0.84
340 0.81
341 0.79
342 0.68
343 0.59
344 0.5
345 0.43
346 0.34
347 0.29
348 0.23
349 0.15
350 0.14
351 0.14
352 0.12
353 0.11
354 0.1
355 0.09
356 0.08
357 0.08
358 0.08
359 0.07
360 0.08
361 0.1
362 0.13
363 0.17
364 0.19
365 0.2
366 0.22
367 0.25
368 0.25
369 0.25
370 0.21
371 0.19
372 0.19
373 0.2
374 0.18
375 0.15
376 0.13
377 0.15
378 0.14
379 0.13
380 0.15
381 0.14
382 0.16
383 0.16
384 0.2
385 0.2