Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2ECT3

Protein Details
Accession A0A0D2ECT3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
65-91EASIRRRGLQSNRKRRLPNRSAKQLVDHydrophilic
NLS Segment(s)
PositionSequence
76-81NRKRRL
Subcellular Location(s) cyto 22, cyto_nucl 13, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036291  NAD(P)-bd_dom_sf  
IPR002347  SDR_fam  
Pfam View protein in Pfam  
PF00106  adh_short  
Amino Acid Sequences MDPVVIVTGAAGGIGLEIVRYLLEELKGRVVAVDIVRGGLDAMAEANPDRLEVILGDISAVSSHEASIRRRGLQSNRKRRLPNRSAKQLVDSAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.02
4 0.02
5 0.03
6 0.03
7 0.03
8 0.04
9 0.06
10 0.08
11 0.1
12 0.11
13 0.13
14 0.13
15 0.12
16 0.12
17 0.11
18 0.11
19 0.1
20 0.1
21 0.08
22 0.08
23 0.08
24 0.08
25 0.07
26 0.05
27 0.04
28 0.03
29 0.03
30 0.03
31 0.03
32 0.03
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.05
41 0.05
42 0.04
43 0.05
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.08
52 0.11
53 0.14
54 0.21
55 0.24
56 0.26
57 0.28
58 0.35
59 0.43
60 0.5
61 0.59
62 0.63
63 0.69
64 0.75
65 0.82
66 0.83
67 0.84
68 0.84
69 0.84
70 0.83
71 0.85
72 0.83
73 0.76
74 0.73