Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q09824

Protein Details
Accession Q09824    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
147-171RDAIKSALRRRMRRREGRVQKALRPBasic
NLS Segment(s)
PositionSequence
151-167KSALRRRMRRREGRVQK
Subcellular Location(s) nucl 14.5, cyto_nucl 12, cyto 8.5, mito 1, plas 1, golg 1, cysk 1
Family & Domain DBs
Gene Ontology GO:0030907  C:MBF transcription complex  
GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
GO:0062070  F:SAGA complex binding  
GO:0003713  F:transcription coactivator activity  
GO:0051301  P:cell division  
GO:0000122  P:negative regulation of transcription by RNA polymerase II  
GO:0071931  P:positive regulation of transcription involved in G1/S transition of mitotic cell cycle  
KEGG spo:SPBC2F12.11c  -  
Amino Acid Sequences MHFADIPLSKPCLNNPPTYPWSSPILSSIANPSLCDIVSSPSSVSSFASSDDFAFMNAYCLPIQQNHQFGSPVAASPNQQPLVESQNRRNVTYASLVIGKLGIAQLIRQQTDPPQIIHRKQDKGLMARVLSRSKKQEERENHSSDARDAIKSALRRRMRRREGRVQKALRPTPNLICSKCNTTFNHSTALMMHEATCLNQVPFKLSDFFVEDVIDDWLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.4
3 0.45
4 0.48
5 0.53
6 0.5
7 0.43
8 0.45
9 0.4
10 0.36
11 0.3
12 0.27
13 0.22
14 0.21
15 0.22
16 0.22
17 0.21
18 0.21
19 0.2
20 0.18
21 0.18
22 0.17
23 0.13
24 0.12
25 0.12
26 0.13
27 0.12
28 0.12
29 0.13
30 0.13
31 0.13
32 0.11
33 0.11
34 0.11
35 0.12
36 0.11
37 0.11
38 0.12
39 0.11
40 0.1
41 0.1
42 0.09
43 0.09
44 0.09
45 0.1
46 0.08
47 0.09
48 0.1
49 0.11
50 0.16
51 0.19
52 0.23
53 0.22
54 0.23
55 0.23
56 0.22
57 0.23
58 0.19
59 0.15
60 0.12
61 0.12
62 0.12
63 0.14
64 0.19
65 0.17
66 0.17
67 0.16
68 0.17
69 0.24
70 0.29
71 0.3
72 0.3
73 0.38
74 0.39
75 0.4
76 0.39
77 0.32
78 0.27
79 0.27
80 0.22
81 0.15
82 0.14
83 0.13
84 0.12
85 0.11
86 0.09
87 0.06
88 0.06
89 0.05
90 0.03
91 0.04
92 0.07
93 0.09
94 0.1
95 0.1
96 0.11
97 0.13
98 0.18
99 0.19
100 0.17
101 0.22
102 0.27
103 0.3
104 0.38
105 0.42
106 0.39
107 0.39
108 0.44
109 0.41
110 0.38
111 0.39
112 0.33
113 0.28
114 0.27
115 0.29
116 0.3
117 0.29
118 0.3
119 0.32
120 0.35
121 0.42
122 0.44
123 0.5
124 0.52
125 0.59
126 0.63
127 0.62
128 0.58
129 0.53
130 0.49
131 0.4
132 0.37
133 0.29
134 0.21
135 0.18
136 0.17
137 0.19
138 0.23
139 0.28
140 0.32
141 0.39
142 0.48
143 0.57
144 0.67
145 0.73
146 0.79
147 0.82
148 0.84
149 0.87
150 0.89
151 0.89
152 0.83
153 0.79
154 0.79
155 0.77
156 0.7
157 0.65
158 0.59
159 0.55
160 0.57
161 0.57
162 0.49
163 0.46
164 0.44
165 0.46
166 0.46
167 0.46
168 0.41
169 0.44
170 0.48
171 0.46
172 0.48
173 0.41
174 0.37
175 0.32
176 0.31
177 0.24
178 0.17
179 0.16
180 0.12
181 0.12
182 0.12
183 0.14
184 0.12
185 0.12
186 0.14
187 0.14
188 0.17
189 0.18
190 0.2
191 0.21
192 0.19
193 0.22
194 0.23
195 0.24
196 0.21
197 0.19
198 0.17
199 0.15