Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2ATE1

Protein Details
Accession A0A0D2ATE1    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
471-495AQGTSARRAWRRERLARQQAREYGQHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 10.5, cyto_nucl 7, mito 5, extr 4, nucl 2.5, pero 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF13639  zf-RING_2  
PROSITE View protein in PROSITE  
PS50089  ZF_RING_2  
CDD cd16454  RING-H2_PA-TM-RING  
Amino Acid Sequences MSAQNFGVIAAVVPDTQYDPNPNVRLVNRTYGLQLRASGLVRTLSQNNPNNYGTIEGLLYVPDLPASDPCDNATRALIPSNVTTRAQIPGQKYPLIALAPWTQIACVESYLSAMASDNVRGGIFFHPGNESEQPPPVSDPSWSLDDGGKWKGDNPYPVYAIPGMLGAFLLDELAQYSGNLSSSPYGKELADLYDSHDVVRLVARFDVNVAGGIPSLWVFLIIVLAVLLTVVLVTSVIMHWVQRKQRRQLQQRVARGEVDLEALGIKRLNVPQDILDKMPQWIYIRSNNDSSGPTESKESVPSAEKISTDTAVSRKAVREVPFSQTTCPICLDDFVHDETTVRELPCNHIYHPECIDPFLRENSSLCPLCKKTVLPAGYCPVQVTNIMVRRERLLRRTRHRDAEDNIDANGSRLPGVAVINRTMRQLSNPLTASRHQHGSAAGEHTTGAEMQSIPQRRQTQVDDEMPAEVRAQGTSARRAWRRERLARQQAREYGQQADQARVVDESRPLWRRIVGRVIPSLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.1
3 0.12
4 0.14
5 0.17
6 0.2
7 0.28
8 0.31
9 0.31
10 0.34
11 0.35
12 0.39
13 0.39
14 0.43
15 0.37
16 0.36
17 0.39
18 0.39
19 0.39
20 0.34
21 0.32
22 0.27
23 0.29
24 0.28
25 0.25
26 0.21
27 0.2
28 0.2
29 0.22
30 0.25
31 0.27
32 0.35
33 0.42
34 0.45
35 0.49
36 0.48
37 0.44
38 0.4
39 0.36
40 0.27
41 0.21
42 0.17
43 0.12
44 0.11
45 0.1
46 0.1
47 0.08
48 0.07
49 0.06
50 0.06
51 0.07
52 0.09
53 0.15
54 0.15
55 0.15
56 0.18
57 0.22
58 0.22
59 0.22
60 0.22
61 0.18
62 0.18
63 0.2
64 0.2
65 0.17
66 0.2
67 0.22
68 0.24
69 0.22
70 0.22
71 0.22
72 0.24
73 0.25
74 0.27
75 0.28
76 0.33
77 0.36
78 0.36
79 0.35
80 0.32
81 0.32
82 0.28
83 0.23
84 0.18
85 0.18
86 0.18
87 0.18
88 0.17
89 0.14
90 0.14
91 0.15
92 0.12
93 0.09
94 0.08
95 0.07
96 0.08
97 0.08
98 0.07
99 0.07
100 0.06
101 0.07
102 0.08
103 0.08
104 0.08
105 0.08
106 0.08
107 0.08
108 0.09
109 0.09
110 0.11
111 0.11
112 0.11
113 0.13
114 0.14
115 0.18
116 0.19
117 0.2
118 0.19
119 0.24
120 0.23
121 0.23
122 0.24
123 0.22
124 0.2
125 0.18
126 0.19
127 0.17
128 0.19
129 0.18
130 0.17
131 0.17
132 0.18
133 0.21
134 0.2
135 0.18
136 0.16
137 0.19
138 0.23
139 0.25
140 0.29
141 0.3
142 0.31
143 0.32
144 0.32
145 0.31
146 0.25
147 0.22
148 0.16
149 0.13
150 0.09
151 0.07
152 0.06
153 0.04
154 0.04
155 0.04
156 0.03
157 0.03
158 0.03
159 0.03
160 0.04
161 0.04
162 0.04
163 0.05
164 0.05
165 0.05
166 0.06
167 0.06
168 0.07
169 0.09
170 0.1
171 0.1
172 0.11
173 0.11
174 0.12
175 0.12
176 0.12
177 0.12
178 0.11
179 0.13
180 0.16
181 0.16
182 0.15
183 0.16
184 0.14
185 0.13
186 0.16
187 0.13
188 0.1
189 0.11
190 0.11
191 0.09
192 0.1
193 0.1
194 0.07
195 0.07
196 0.06
197 0.05
198 0.05
199 0.05
200 0.05
201 0.04
202 0.04
203 0.03
204 0.03
205 0.03
206 0.03
207 0.03
208 0.03
209 0.03
210 0.02
211 0.02
212 0.02
213 0.02
214 0.02
215 0.01
216 0.01
217 0.01
218 0.01
219 0.02
220 0.02
221 0.02
222 0.02
223 0.03
224 0.04
225 0.05
226 0.08
227 0.13
228 0.2
229 0.28
230 0.36
231 0.43
232 0.51
233 0.61
234 0.68
235 0.73
236 0.77
237 0.77
238 0.77
239 0.72
240 0.66
241 0.56
242 0.46
243 0.36
244 0.26
245 0.18
246 0.11
247 0.07
248 0.06
249 0.05
250 0.06
251 0.05
252 0.05
253 0.06
254 0.07
255 0.09
256 0.09
257 0.1
258 0.12
259 0.15
260 0.16
261 0.15
262 0.15
263 0.14
264 0.14
265 0.14
266 0.13
267 0.12
268 0.13
269 0.15
270 0.2
271 0.24
272 0.25
273 0.26
274 0.25
275 0.25
276 0.24
277 0.23
278 0.22
279 0.19
280 0.17
281 0.17
282 0.18
283 0.17
284 0.18
285 0.17
286 0.13
287 0.15
288 0.16
289 0.16
290 0.16
291 0.15
292 0.15
293 0.16
294 0.14
295 0.13
296 0.13
297 0.12
298 0.14
299 0.14
300 0.15
301 0.14
302 0.17
303 0.22
304 0.22
305 0.27
306 0.27
307 0.32
308 0.35
309 0.35
310 0.33
311 0.33
312 0.32
313 0.27
314 0.26
315 0.21
316 0.16
317 0.16
318 0.16
319 0.13
320 0.14
321 0.14
322 0.14
323 0.13
324 0.13
325 0.13
326 0.15
327 0.15
328 0.13
329 0.13
330 0.13
331 0.19
332 0.24
333 0.26
334 0.23
335 0.29
336 0.31
337 0.33
338 0.35
339 0.32
340 0.27
341 0.27
342 0.27
343 0.21
344 0.21
345 0.21
346 0.19
347 0.17
348 0.18
349 0.19
350 0.25
351 0.24
352 0.22
353 0.26
354 0.27
355 0.29
356 0.3
357 0.28
358 0.27
359 0.33
360 0.35
361 0.31
362 0.32
363 0.34
364 0.33
365 0.33
366 0.28
367 0.2
368 0.18
369 0.17
370 0.16
371 0.18
372 0.22
373 0.24
374 0.25
375 0.26
376 0.28
377 0.36
378 0.39
379 0.41
380 0.44
381 0.52
382 0.61
383 0.7
384 0.74
385 0.77
386 0.77
387 0.75
388 0.7
389 0.7
390 0.65
391 0.55
392 0.48
393 0.39
394 0.34
395 0.27
396 0.24
397 0.15
398 0.09
399 0.08
400 0.08
401 0.08
402 0.1
403 0.13
404 0.13
405 0.16
406 0.2
407 0.21
408 0.22
409 0.22
410 0.21
411 0.21
412 0.25
413 0.27
414 0.3
415 0.31
416 0.32
417 0.34
418 0.37
419 0.4
420 0.38
421 0.38
422 0.32
423 0.32
424 0.31
425 0.3
426 0.3
427 0.27
428 0.23
429 0.19
430 0.18
431 0.17
432 0.16
433 0.13
434 0.1
435 0.08
436 0.08
437 0.1
438 0.18
439 0.23
440 0.23
441 0.31
442 0.36
443 0.37
444 0.43
445 0.45
446 0.45
447 0.48
448 0.51
449 0.45
450 0.41
451 0.4
452 0.36
453 0.31
454 0.24
455 0.18
456 0.14
457 0.11
458 0.11
459 0.14
460 0.17
461 0.24
462 0.28
463 0.36
464 0.42
465 0.49
466 0.58
467 0.63
468 0.69
469 0.73
470 0.79
471 0.81
472 0.87
473 0.88
474 0.86
475 0.84
476 0.81
477 0.76
478 0.71
479 0.62
480 0.56
481 0.5
482 0.49
483 0.42
484 0.38
485 0.35
486 0.3
487 0.28
488 0.25
489 0.23
490 0.2
491 0.21
492 0.21
493 0.28
494 0.32
495 0.33
496 0.34
497 0.39
498 0.4
499 0.44
500 0.51
501 0.47
502 0.48