Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q9P7N1

Protein Details
Accession Q9P7N1    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
44-66VCLLKCRPAKRWRHPILDQKLSRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022495  Bud32  
IPR011009  Kinase-like_dom_sf  
IPR000719  Prot_kinase_dom  
IPR008266  Tyr_kinase_AS  
Gene Ontology GO:0000781  C:chromosome, telomeric region  
GO:0005829  C:cytosol  
GO:0000408  C:EKC/KEOPS complex  
GO:0005634  C:nucleus  
GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
GO:0106310  F:protein serine kinase activity  
GO:0004674  F:protein serine/threonine kinase activity  
GO:0006468  P:protein phosphorylation  
GO:0070525  P:tRNA threonylcarbamoyladenosine metabolic process  
GO:0002949  P:tRNA threonylcarbamoyladenosine modification  
KEGG spo:SPAP27G11.07c  -  
Pfam View protein in Pfam  
PF00069  Pkinase  
PROSITE View protein in PROSITE  
PS50011  PROTEIN_KINASE_DOM  
PS00109  PROTEIN_KINASE_TYR  
Amino Acid Sequences MSEKPDLRQRCSDIYREIKEKKLTVVKQGAEAITIKTEFYPGEVCLLKCRPAKRWRHPILDQKLSRKRCLVEARLLAKCHYVGIKCPMLYFIDANRGQIYMEWIDGPCVRDYIREICECEIEKKLIPLMKRIGSEVAKMHKNDIVHGDLTTSNMMLESHNNPVPIFIDFGLGSVSESEEDKAVDIYVLERALSSTLPESESLFHHVLDSYAQSWKQSKATLRRFEEVRMRGRKRTMIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.62
3 0.63
4 0.63
5 0.61
6 0.63
7 0.6
8 0.59
9 0.59
10 0.55
11 0.56
12 0.59
13 0.53
14 0.5
15 0.52
16 0.43
17 0.35
18 0.33
19 0.25
20 0.19
21 0.18
22 0.15
23 0.12
24 0.13
25 0.11
26 0.12
27 0.12
28 0.1
29 0.14
30 0.17
31 0.17
32 0.22
33 0.24
34 0.3
35 0.32
36 0.36
37 0.4
38 0.47
39 0.58
40 0.62
41 0.72
42 0.73
43 0.77
44 0.81
45 0.83
46 0.82
47 0.82
48 0.76
49 0.75
50 0.76
51 0.72
52 0.67
53 0.61
54 0.53
55 0.51
56 0.55
57 0.49
58 0.48
59 0.51
60 0.53
61 0.53
62 0.52
63 0.44
64 0.37
65 0.32
66 0.25
67 0.21
68 0.16
69 0.15
70 0.2
71 0.23
72 0.21
73 0.21
74 0.21
75 0.19
76 0.19
77 0.17
78 0.12
79 0.18
80 0.18
81 0.18
82 0.18
83 0.17
84 0.15
85 0.15
86 0.16
87 0.08
88 0.08
89 0.08
90 0.08
91 0.09
92 0.1
93 0.11
94 0.09
95 0.09
96 0.09
97 0.09
98 0.11
99 0.14
100 0.16
101 0.16
102 0.17
103 0.17
104 0.19
105 0.19
106 0.18
107 0.16
108 0.14
109 0.13
110 0.13
111 0.14
112 0.15
113 0.14
114 0.17
115 0.19
116 0.21
117 0.21
118 0.22
119 0.23
120 0.22
121 0.23
122 0.22
123 0.23
124 0.24
125 0.23
126 0.24
127 0.22
128 0.21
129 0.21
130 0.21
131 0.18
132 0.15
133 0.14
134 0.14
135 0.13
136 0.14
137 0.12
138 0.09
139 0.06
140 0.06
141 0.07
142 0.06
143 0.09
144 0.1
145 0.14
146 0.15
147 0.16
148 0.15
149 0.16
150 0.16
151 0.14
152 0.13
153 0.09
154 0.09
155 0.09
156 0.09
157 0.09
158 0.08
159 0.07
160 0.06
161 0.06
162 0.05
163 0.06
164 0.07
165 0.07
166 0.07
167 0.07
168 0.07
169 0.07
170 0.06
171 0.06
172 0.06
173 0.07
174 0.07
175 0.07
176 0.06
177 0.07
178 0.08
179 0.08
180 0.08
181 0.08
182 0.09
183 0.1
184 0.11
185 0.12
186 0.13
187 0.14
188 0.19
189 0.17
190 0.16
191 0.16
192 0.16
193 0.15
194 0.15
195 0.15
196 0.11
197 0.15
198 0.16
199 0.19
200 0.22
201 0.25
202 0.27
203 0.31
204 0.38
205 0.44
206 0.54
207 0.6
208 0.63
209 0.66
210 0.65
211 0.66
212 0.67
213 0.64
214 0.63
215 0.64
216 0.64
217 0.65
218 0.69