Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2B9A0

Protein Details
Accession A0A0D2B9A0    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
55-76EAFRQCWKRKGNEERTRSKDTAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10.333, cyto 5, cyto_pero 4.333, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR010625  CHCH  
IPR039870  Coa4-like  
Gene Ontology GO:0005758  C:mitochondrial intermembrane space  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
Pfam View protein in Pfam  
PF06747  CHCH  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MSGEQKVEKTQVDDDDELDEWDQRIFSTGCAEEQLRMNDCYYDKKDWRLCRNEMEAFRQCWKRKGNEERTRSKDTALSEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.25
4 0.22
5 0.19
6 0.16
7 0.11
8 0.11
9 0.1
10 0.07
11 0.1
12 0.09
13 0.09
14 0.11
15 0.11
16 0.11
17 0.13
18 0.14
19 0.12
20 0.15
21 0.17
22 0.15
23 0.16
24 0.16
25 0.16
26 0.16
27 0.2
28 0.2
29 0.24
30 0.24
31 0.3
32 0.37
33 0.43
34 0.51
35 0.52
36 0.52
37 0.52
38 0.56
39 0.55
40 0.51
41 0.51
42 0.47
43 0.44
44 0.48
45 0.51
46 0.48
47 0.49
48 0.52
49 0.53
50 0.58
51 0.67
52 0.71
53 0.72
54 0.79
55 0.82
56 0.83
57 0.83
58 0.74
59 0.65
60 0.58