FuNGI

A0A0D2AGG5

Protein Details

Accession

A0A0D2AGG5

Localization Confidence

Medium

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
349-372	SFRGSRGSGAKKKQRRIDLFPARW	Hydrophilic

NLS Segment(s)

Position	Sequence
339-344	RRQRPG
350-364	FRGSRGSGAKKKQRR

Subcellular Location(s)

cyto 12, pero 6, nucl 5, mito 2

Family & Domain DBs

InterPro	View protein in InterPro IPR025213 Sim4_Fta2
Pfam	View protein in Pfam PF13095 FTA2

Amino Acid Sequences

MYPDWPESEADLMPPPQVDGPKLKAFKFSRARKIDFLEYAGAGTHSQVFKVKIEGEIYALKVFRWTDGDEWPGPDIDPDAYSHEALTAFANHAEPFNCECRAFARLQESGHEDLAIRCFGYVLINEEEEKEMVDRFEVSFDSEEFGGFPAYMGKQRARYPGKRSGREPPLRAIVKAFGKVDTLFNASVVKKMFRDIVQLHRLGIASLDVATRQLVDGKPSDLSQALTTPNFIMTPELNPLLSPEQVARLENETFRCCRTDFARLEDLVLVWNQEHKKARDKIWIDPFPNQRQHNLRKMPARRNNLPYTFADPRLYDWRKSSVASDESEGSINATAKGGRRQRPGGNVDSFRGSRGSGAKKKQRRIDLFPARWYYECDDKEAADLEGWRDAYPRLSEYEYRDGLIFPPAPKKPPPPMAPLSELAPEHRRTLEAFGTIPRQT

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.17
2	0.17
3	0.18
4	0.2
5	0.22
6	0.24
7	0.3
8	0.38
9	0.42
10	0.41
11	0.48
12	0.49
13	0.55
14	0.59
15	0.63
16	0.65
17	0.69
18	0.74
19	0.7
20	0.73
21	0.7
22	0.62
23	0.55
24	0.47
25	0.38
26	0.33
27	0.27
28	0.22
29	0.15
30	0.13
31	0.15
32	0.13
33	0.14
34	0.17
35	0.19
36	0.19
37	0.23
38	0.23
39	0.21
40	0.23
41	0.22
42	0.21
43	0.22
44	0.22
45	0.21
46	0.2
47	0.17
48	0.19
49	0.18
50	0.17
51	0.18
52	0.19
53	0.19
54	0.22
55	0.28
56	0.26
57	0.27
58	0.26
59	0.23
60	0.21
61	0.19
62	0.16
63	0.12
64	0.11
65	0.11
66	0.13
67	0.15
68	0.15
69	0.14
70	0.14
71	0.13
72	0.13
73	0.13
74	0.1
75	0.1
76	0.1
77	0.11
78	0.1
79	0.12
80	0.12
81	0.14
82	0.16
83	0.19
84	0.2
85	0.19
86	0.19
87	0.2
88	0.23
89	0.21
90	0.21
91	0.23
92	0.23
93	0.24
94	0.27
95	0.29
96	0.27
97	0.26
98	0.23
99	0.18
100	0.17
101	0.19
102	0.16
103	0.11
104	0.09
105	0.09
106	0.08
107	0.09
108	0.09
109	0.11
110	0.12
111	0.13
112	0.13
113	0.14
114	0.15
115	0.13
116	0.13
117	0.09
118	0.08
119	0.08
120	0.08
121	0.08
122	0.07
123	0.08
124	0.08
125	0.09
126	0.1
127	0.1
128	0.11
129	0.1
130	0.09
131	0.08
132	0.09
133	0.07
134	0.06
135	0.06
136	0.06
137	0.07
138	0.11
139	0.13
140	0.15
141	0.2
142	0.23
143	0.33
144	0.39
145	0.45
146	0.49
147	0.57
148	0.64
149	0.65
150	0.65
151	0.65
152	0.68
153	0.68
154	0.64
155	0.57
156	0.57
157	0.53
158	0.49
159	0.41
160	0.35
161	0.3
162	0.3
163	0.27
164	0.18
165	0.18
166	0.19
167	0.18
168	0.14
169	0.15
170	0.12
171	0.12
172	0.14
173	0.13
174	0.14
175	0.15
176	0.14
177	0.12
178	0.13
179	0.16
180	0.13
181	0.19
182	0.19
183	0.26
184	0.29
185	0.29
186	0.28
187	0.27
188	0.26
189	0.21
190	0.18
191	0.1
192	0.05
193	0.05
194	0.05
195	0.04
196	0.04
197	0.04
198	0.04
199	0.04
200	0.07
201	0.06
202	0.08
203	0.09
204	0.1
205	0.11
206	0.11
207	0.11
208	0.09
209	0.1
210	0.08
211	0.09
212	0.1
213	0.09
214	0.1
215	0.09
216	0.09
217	0.08
218	0.08
219	0.07
220	0.06
221	0.08
222	0.09
223	0.09
224	0.09
225	0.09
226	0.1
227	0.1
228	0.1
229	0.09
230	0.08
231	0.1
232	0.11
233	0.12
234	0.11
235	0.12
236	0.14
237	0.15
238	0.18
239	0.17
240	0.17
241	0.18
242	0.19
243	0.17
244	0.18
245	0.19
246	0.26
247	0.25
248	0.3
249	0.33
250	0.31
251	0.31
252	0.29
253	0.26
254	0.18
255	0.16
256	0.11
257	0.06
258	0.12
259	0.11
260	0.16
261	0.22
262	0.24
263	0.33
264	0.38
265	0.43
266	0.47
267	0.49
268	0.52
269	0.57
270	0.61
271	0.54
272	0.56
273	0.6
274	0.58
275	0.63
276	0.56
277	0.52
278	0.55
279	0.6
280	0.62
281	0.61
282	0.6
283	0.61
284	0.69
285	0.73
286	0.73
287	0.74
288	0.72
289	0.73
290	0.75
291	0.68
292	0.63
293	0.55
294	0.53
295	0.49
296	0.43
297	0.38
298	0.3
299	0.31
300	0.38
301	0.38
302	0.33
303	0.32
304	0.35
305	0.34
306	0.35
307	0.33
308	0.29
309	0.29
310	0.28
311	0.27
312	0.23
313	0.22
314	0.22
315	0.2
316	0.14
317	0.13
318	0.12
319	0.11
320	0.1
321	0.11
322	0.13
323	0.22
324	0.29
325	0.34
326	0.41
327	0.46
328	0.51
329	0.58
330	0.6
331	0.59
332	0.59
333	0.54
334	0.5
335	0.49
336	0.44
337	0.36
338	0.32
339	0.25
340	0.21
341	0.26
342	0.34
343	0.37
344	0.47
345	0.56
346	0.64
347	0.73
348	0.77
349	0.8
350	0.78
351	0.79
352	0.8
353	0.81
354	0.78
355	0.77
356	0.74
357	0.66
358	0.59
359	0.54
360	0.47
361	0.45
362	0.4
363	0.37
364	0.33
365	0.31
366	0.32
367	0.29
368	0.25
369	0.17
370	0.18
371	0.14
372	0.17
373	0.17
374	0.15
375	0.15
376	0.16
377	0.18
378	0.19
379	0.19
380	0.19
381	0.23
382	0.27
383	0.32
384	0.4
385	0.37
386	0.35
387	0.34
388	0.31
389	0.28
390	0.3
391	0.27
392	0.22
393	0.3
394	0.32
395	0.37
396	0.42
397	0.49
398	0.52
399	0.58
400	0.61
401	0.6
402	0.63
403	0.64
404	0.63
405	0.57
406	0.5
407	0.45
408	0.4
409	0.37
410	0.37
411	0.34
412	0.32
413	0.31
414	0.3
415	0.28
416	0.32
417	0.31
418	0.27
419	0.27
420	0.28

A0A0D2AGG5

3D AlphaFold-predicted Structure Viewer