Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2C6X3

Protein Details
Accession A0A0D2C6X3    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
77-103ASVPYRYTPYRQKRPTRTQTTYHYRRRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MPSPQVQRREPFQPGFQLRPDSCNCYLNSSHPSTLQLLRMLSNPSVFARARARVCVQNRSLLATGTIQHQSTDPQYASVPYRYTPYRQKRPTRTQTTYHYRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.52
3 0.51
4 0.52
5 0.45
6 0.47
7 0.46
8 0.43
9 0.4
10 0.4
11 0.37
12 0.34
13 0.34
14 0.33
15 0.35
16 0.32
17 0.31
18 0.27
19 0.29
20 0.26
21 0.27
22 0.25
23 0.21
24 0.18
25 0.18
26 0.19
27 0.19
28 0.16
29 0.14
30 0.13
31 0.11
32 0.15
33 0.14
34 0.15
35 0.16
36 0.2
37 0.21
38 0.22
39 0.24
40 0.27
41 0.3
42 0.34
43 0.31
44 0.31
45 0.31
46 0.32
47 0.3
48 0.23
49 0.21
50 0.16
51 0.15
52 0.13
53 0.15
54 0.12
55 0.12
56 0.12
57 0.13
58 0.14
59 0.17
60 0.14
61 0.14
62 0.14
63 0.16
64 0.19
65 0.2
66 0.19
67 0.16
68 0.21
69 0.22
70 0.28
71 0.36
72 0.44
73 0.52
74 0.61
75 0.71
76 0.77
77 0.86
78 0.91
79 0.9
80 0.86
81 0.82
82 0.83
83 0.83